SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK678.2 from Caenorhabditis elegans WormBase WS218

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK678.2
Domain Number 1 Region: 115-327
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-39
Family Nuclear receptor ligand-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 8-103
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.02e-20
Family Nuclear receptor 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: ZK678.2   Protein: CE15385   Gene: WBGene00014068
Sequence length 342
Comment CE15385 WBGene00014068 locus:nhr-255 Ligand-binding domain of nuclear hormone receptors, Zinc finger, C4 type (two domains) status:Partially_confirmed UniProt:Q94411 protein_id:CAB01903.1
Sequence
MTHFRKVENCIICDRETSLFNYGAISCNACKLFFRRAKVSKTEISPCSNRNLCHKTKMST
WKSACKSCRLLKCVKAGMTLNSTDQNFNMKTSDRIYDLIQNLHHLNLTRMTLASSHCVSQ
TDPSIYEIAQLPSKISFVPRPEALEMKLNDWIFLQINTTIDFVKKLPAVKDLNLSDRALF
LKHCHQCFTLISLSYEAMSDKKCYMSMPDGSNILPIQPSLKLENFANVIKSQLVGRMIQL
RVTKEEYLLMAVLFACNPTDINISLYGKTILNTQQKEFSNALLQYCFSNYQRTGPSRFGD
LLSLCSAVIKTRQDCSSFFLLTNYPGPTFKLFNEIGQSFQNC
Download sequence
Identical sequences Q94411
ZK678.2 ZK678.2 6239.ZK678.2 NP_510590.1.50509 ZK678.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]