SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 180.m00295 from Cryptococcus neoformans JEC21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  180.m00295
Domain Number 1 Region: 195-282
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.83e-21
Family Elongation factor TFIIS domain 2 0.0018
Further Details:      
 
Domain Number 2 Region: 6-79
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3.79e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00092
Further Details:      
 
Domain Number 3 Region: 303-338
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000000000794
Family Transcriptional factor domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 180.m00295
Sequence length 349
Comment |CNF01160||positive transcription elongation factor, putative|Cryptococcus neoformans|chr_6|chr7|180
Sequence
MDATTLTGHVKELNAANQAGKSDEVISLLKKLQAEVVPTEDLLRSSKAGVAVGKLRTHAT
PSVSSLAKEIVKKWRDAVEETKKKRKRAEGDEGKDVKKEKEEGNGKRVKAESMCALSPAA
ESGSDTHIHFAAGSLAATPSASTPASASTPDVKATSPPVRQPLSTIDSSRTTPRTAKSDG
VADSLRADSSEGGSVDSVRDKCVIMIYDALALDSTAERAIGIERAANKAMNFSTGNDYRA
KMRSLFLNLKDKGNPALRNEIVLGYVSTEKVASMSKDEMASESVRMLKEKIASDNLFKAK
AVGVTQAETDAFKCGRCHQRKCTYYQMQTRSADEPMTVSRYLAHMIRWY
Download sequence
Identical sequences F5HGK5
214684.CNF01160 sgtc|cn06360 180.m00295 XP_571548.1.95466 XP_774677.1.65578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]