SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 179.m00428 from Cryptococcus neoformans JEC21

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  179.m00428
Domain Number 1 Region: 566-766
Classification Level Classification E-value
Superfamily Sec7 domain 3.79e-61
Family Sec7 domain 0.0000123
Further Details:      
 
Domain Number 2 Region: 293-407,828-865,1093-1166,1367-1418
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000018
Family Armadillo repeat 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 179.m00428
Sequence length 1526
Comment |CNC05000||golgi-specific brefeldin a-resistance guanine nucleotide exchange factor 1 (bfa-resistant gef 1), putative|Cryptococcus neoformans|chr_3|chr3|179
Sequence
MPPTDLPPTTLLLQEVQSVTSAMRRNQRWASSSTSYGSYPTLPPSLRSKNNGLAGAGSRR
GRASLDTGDSVDLMDGSSSTSGPITALALTSLYSIINAVLPLYLTPVPTTFSPSTPLQLA
LVHITSAISHCRFPSSSPQQDELVLLKLLRVIESLVIPMAMPTTEGTVQMGNLLDHMGDE
SVCELLEVGLGMLARARLGEGVRATAQSCVQNIVTSAFRRLKGLQKEDVDKLLEDAKHHE
EKIKVSSKKIESVGQKEEHPDAKQEKQDEMITESEEKPTEPQVNTPMFTPYGLPTILELL
RVLIALLDPNDQAHTDSMRFSALAILNTALEVGGLGLGNWPELREGVTDEGCKYLFQLTR
ADSPSLLAQSLRTTSTLFSTLLPHLRPQLELFLSYLIDRLTPSNPAPLPPQFLNLRSDSR
PSTPSVKTEGRVTPVADASTIESSSPASTPKPVSLLPPVPNETRELMLDSLTQVALRPSF
MVDCWVNFDCSTDSEDLFERLIAFLTRGVYPHGPPKSDGSSHFFEGLDSTQLLSLEILLA
FVSSMADRLEQGDETWPSEAPTTASLKEAKGRKAVILTGAALFNTKPKNGLSFLEEKGII
VPDPADEGTDEEKRHLAIARFLRHCSRLDKKLLGEFISRPDQLGLLKAYIGLFNFSGKSV
ADAMRELLETFRLPGEAQPIARITETFAEHFFSFSPPEIADQDAVYVLAYSVIMLNTDLH
NPQNRKRMTVEDYRKNLRGVNGGKDFDPAYLEGIHESIRKREIILPEEHAGQHGFEYAWK
TLMQRSRTSGPMVICNTSIFDEHMFGLAWRPLISSIAYAFTMSAGDEHVIQKAITGFRQV
ASLASHYHLPDVFDTIVQSLSSATGLLDDTEEGYQMSNYPVVEKEGQSLTVSPLSIRFGQ
SYRAQLATVVLFTIANGNGSAICEGWHQIFEMFQTLFLHSLLPARMLQMEDFLAGTSTIP
MKTAVPHAQLDRRPEGGLLSTLSSYLLSPYGTGSEGVVVETSEEDVENTLVAVDCLSSCK
LEELYAEILNLPVDALIPALRAIRALAESRTTDKLKSRTVQRVETGSPVISPRFEGQLPY
DPACVFHLEMMVSLASRNKQNIAETWPIIFEYISELLSSAQSYSVLLIERAVVGLLRLCL
VVSEQPELRDQLYIALDVLRSLPSTVLNAVSEQLMAGVALVLEKDATVIKSQTEWNLVIA
LFRATVAHPEASKVTLAIVQKMAALPKQQEGENVGEGKGTGLTVDNYGGVVALLDEFATQ
AGAAAAGRQQQQRRSSVGPQSGSLGPTVERGLAALDSLYELRNVIPALMASNNLEEQQAF
NTFWLPPLLVIGKQCINGCRDIRQRAITYLQRLLLSPQILLGNESTLPIVFDRVLFPVLE
ELLKPQVYERDPKGLSETRLKAATLLCKIFLQYVVRLVESGSSEAVTGLFVRVLDKLERF
MRGERDLLNEASESLKNVVLVMHSSNLLIPPPSSGSPDERTRDQKGLWEKSAQRIERVLP
GFLREAIPPSEPPQVQKQVGQQVEQS
Download sequence
Identical sequences 179.m00428 XP_569791.1.95466 214684.CNC05000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]