SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0350.2a.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0350.2a.1
Domain Number 1 Region: 426-815
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.91e-130
Family Ankyrin repeat 0.00000000181
Further Details:      
 
Domain Number 2 Region: 70-441
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.42e-105
Family Ankyrin repeat 0.000000251
Further Details:      
 
Domain Number 3 Region: 1491-1575
Classification Level Classification E-value
Superfamily DEATH domain 4.71e-16
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: B0350.2a.1   Gene: WBGene00006780   Transcript: B0350.2a.1
Sequence length 2039
Comment pep:known chromosome:WBcel235:IV:5975557:5987479:1 gene:WBGene00006780 transcript:B0350.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNEGDPPQPQQQQPESQEVQAPAAPEPGRAEGSASFLRAARAGDLEKVLELLRAGTDIN
TSNANGLNSLHLASKEGHSEVVRELIKRQAQVDAATRKGNTALHIASLAGQSLIVTILVE
NGANVNVQSVNGFTPLYMAAQENHEEVVKYLLKHGANQALSTEDGFTPLAVALQQGHDRV
VAVLLENDSKGKVRLPALHIAAKKDDTTAATLLLQNEHNPDVTSKSGFTPLHIAAHYGHE
NVGQLLLEKGANVNYQARHNISPLHVATKWGRTNMANLLLSRGAIIDSRTKDLLTPLHCA
ARSGHDQVVDLLVVQGAPISAKTKNGLAPLHMAAQGDHVDAARTLLYHRAPVDDVTVDYL
TPLHVAAHCGHVRVAKLLLDRSADPNSRALNGFTPLHIACKKNRIKVVELLLKYRAAIEA
TTESGLTPLHVAAFMGAINIVIYLLQQGANPDVETVRGETPLHLAARANQTDVVRVLIRN
GAKVDAQARELQTPLHIASRLGNTDIVILLLQAGANSNATTRDNYSPLHIAAKEGQEEVA
GILLDHNADKTLLTKKGFTPLHLASKYGNLEVVRLLLERGTPVDIEGKNQVTPLHVAAHY
NNDKVAMLLLENGASAKAAAKNGYTPLHIAAKKNQMEIASTLLQFKADPNAKSRAGFTPL
HLSAQEGHKEISGLLIENGSDVGAKANNGLTAMHLCAQEDHVPVAQILYNNGAEINSKTN
AGYTPLHVACHFGQLNMVKFLVENGADVGEKTRASYTPLHQAAQQGHNNCVRYLLENGAS
PNEQTATGQTPLSIAQRLGYVSVVETLRTVTETTVITETTTVDERYKPQNPEAMNETMFS
ESEDEGQAAEHEAVAAHEKDFSDNLTQGLQDSTGVHMIHTGEQLLQRSQELENGGAIPKI
NSGGMSPEKEFAKIAPVATSSPIATSNSQSFGIAPRAGSISGQFQQQPLHGAGPEDNLEE
LVRRAQNHPINAGNYDNGGVAMLENGHADNVPIGHHVTQPSFLISFLVDARGGAMRGCRH
SGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKFLGPVIL
EVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQLDDLQTP
RITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKTIKVSVQ
AQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQYSGQQGQ
EPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTPRDAARM
AQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLIAKSRDV
EVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAATEGRIGF
MAEPKIRSDALPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEKDLPEFV
HQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKNTLKIWIHLKKEDANQDNLDQ
ALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIRHFEEVPAATLVKREVRTEDLV
TREPVQPTHHVEQATTVVQEPSYSAPVHHSPVPEEPEMEEEAPVAEMRTVVRTERHVHDS
EDGPVVEERTITTTYEDDVAVNENIVDRTVPLNEDEQQNFRKMSSTANYIVSGVLSDGTP
IVFGAVPSDGTSHTAIHHVNSASHFQVESWDGEHAEHPQESEEPRRFSIFLEAGGAEKDG
SSPFDNQEEDEPIASCKQFERTRSASLAAALLELDPRGVPLVQFFKLATDEPLFEVDEGE
DEVEPTEAELVLSQLLFTLRSLKMSEADGKHSEAVQRLRELEEELRAAGAVTPSDPAVTE
AVARALAVAGAGRDVQIRVNQSKHTTTTKTVYETETSAMAHMDVDQIRKLQQDIIADISS
GAEQHSGQDSGTTQKKETAEEGFTNEDGSVVVSKKMTRVVTTTRTTLPGEGEEPSAPGE
Download sequence
Identical sequences B0350.2a B0350.2A B0350.2a.1 B0350.2a.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]