SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0350.2d.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0350.2d.2
Domain Number 1 Region: 477-561
Classification Level Classification E-value
Superfamily DEATH domain 1.45e-16
Family DEATH domain, DD 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: B0350.2d.2   Gene: WBGene00006780   Transcript: B0350.2d.2
Sequence length 795
Comment pep:known chromosome:WBcel235:IV:5980003:5985382:1 gene:WBGene00006780 transcript:B0350.2d.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGCRHSGVRIIVPPRKASQPIRVTCRYLRKDKLAHPPPLSEGEELASRILEMAPAGAKF
LGPVILEVPHFASLRDREREIVILRSDDGQHWKEHQLEATEDAVQEVLNESFDAEDLAQL
DDLQTPRITRILTSDFPMYFAVVTRVRQEVHCVGPEGGVIISSVVPRVQAIFPDGSLTKT
IKVSVQAQPVPQEMVTRLHGNRVAVSPIVTVEPRRRKFHKPITLCIPLPQSNNRGMLTQY
SGQQGQEPPTLRLLCSITGGSAPAQWEDITGTTQLTFTGDEVSFTTTVSARFWLMDCQTP
RDAARMAQEVYNEAISIPYMAKFAVFARRTFPVEGQLRVFCMTDDKEDKTLEKQEHFKLI
AKSRDVEVLKGKHQFLEFSGNLVPITKSGDQLSLFFLPFQENRLAFMVKTRSNDDNEAAT
EGRIGFMAEPKIRSDALPPQQPICTLAISLPEYTGEIKTAPPPKKDLTPFEQRYGSALEK
DLPEFVHQNVLKGIGADWPRLGRALEVPHRDIQHIRQNYPGQECKNTLKIWIHLKKEDAN
QDNLDQALRQIGRDDIVRSIAYGEPDALINYSQADSPSQKREPIRHFEEVPAATLVKREV
RTEDLVTREPVQPTHHVEQATTVVQEPSYSAPVHHSPVPEEPEMEEEAPVAEMRTVVRTE
RHVHDSEDGPVVEERTITTTYEDDVAVNENIVDRTVPLNEDEQQKWEELNRLADESSPSP
AQRSTIVAESTSEQVPEDVEQSVESESHREDDGTIVTTTVTTSHISESPSGSPTRRSVEP
EEHRHSQHEDHEGST
Download sequence
Identical sequences Q5TYL5
NP_001021267.1.50509 B0350.2d B0350.2d.1 B0350.2d.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]