SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C01F6.8b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  C01F6.8b
Domain Number - Region: 25-83
Classification Level Classification E-value
Superfamily PH domain-like 0.0348
Family VPS36 N-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C01F6.8b   Gene: WBGene00002046   Transcript: C01F6.8b
Sequence length 225
Comment pep:known chromosome:WBcel235:IV:9094547:9095655:-1 gene:WBGene00002046 transcript:C01F6.8b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILTEVSQPTEGIKLATTNVQAFFKIDSLGNGTLYITDSAVIWISSAAGTKGFSVAYPAI
VLHAISTDVSVFPSEHIFVMVDQRKSVRRRRRAPVLRTIQEDDEQRGLELAAAELEDEES
DDDEEEPALEIRFVPDDKDSLSQIYHQIAVGQEENPEEDDPMYDDEEEEMEEEMGDDGQG
QSGQWFTADNIDHMQMSEEGLANMQRIFGRGDQHQHHHNEDESME
Download sequence
Identical sequences G5EG22
C01F6.8a.2 G_YK6358 6239.C01F6.8b C01F6.8b NP_001021288.1.50509 C01F6.8b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]