SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C14A11.3b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C14A11.3b
Domain Number 1 Region: 654-836
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.28e-34
Family DBL homology domain (DH-domain) 0.00017
Further Details:      
 
Domain Number 2 Region: 843-980
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000184
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 362-500
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000414
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C14A11.3b   Gene: WBGene00006496   Transcript: C14A11.3b
Sequence length 1055
Comment pep:known chromosome:WBcel235:X:2772042:2799243:1 gene:WBGene00006496 transcript:C14A11.3b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAPSCYGSMVASTSEEVTTSTLSRGPMTMSVSKSNSQFIEAPAFFYDMDTDLKDLKTA
LKDVDLLNDSGYRSVMERSTHPFATSLVFHEDNGFDSEDDATDEHWDGYLTVGGDRIKIR
DMSDILATRYAFISGARTTEGLTIVTFPDSRSTLPFEDYSLLVKYLLQVPPLEDSHKGFV
IIIDRRSDKWSSVRTLLLQISSFFPGKICVTFVIKPEGVLQRALEVGYRGAADTCSFQVI
QLESSAELRKYIHHEFLTMDVGGLIKYNHLEWVQHRMDIERMKASATAIAASLTEFGKTL
RETELPNDADSTARILELQTAEKMAIKEEFKIAVRKGFTLLKSVRQLDKKPTPEQLSPTR
LHNVTAIERMLVQLEETERSFDSFWTKHERRLRYCLELRQFEDSFRKLQAAFARHMLYLE
EHREVGNCTEKALHLAEQHRQYAEGAMEEVEASRNLKKAGEDLINSNEAELSGSLEPKCE
ELERMAAALTSALERRGDCLKRSATMHEQIAKANSWCTRGADLLTNGMTDFTNPNPSSSL
TTLDAFIEEGTNLNIEFLKDTTSPMNQLLLLTTIETSTLLNLIEERIGDIRRMSLAKRDQ
LTKLHLQKPPPVQVVTPEKKSKKNSSKNELDSKDVPSCSGESTPAGTLSPRRETREVTNA
FDEMIATEISYVADLKDIIIHYLEPFEATENQNSLPDTLRGKPDCLFGNVRELYKFHHRT
VLEDLVAARSTAEMCRVLMQHRNQIYVTYRTYCQIHGSNQKVRDSVKNHPFFKECQRNAN
HNMDMSSYLLKPIQRIMKYQLLLGNIMDDCPADVRDEVAMTRDSMVELLNQIDASMQQLH
ISGYNGDLKSLGLLRLQTECDVFTYNRKKKAKLSRAQKRFIFFFDGAVMFCKKRVSNPGT
TLNSEPEYFEHKFCIPIISLGYDTSSRTGASRFEVWDDAKTDAYVIETIDQTARTKWIQR
LGKSETAQDACLENRQRPKSWASTVSNESSCSSSTRESDSTDSTMDTNGNTQTTQVDVPY
SPTLDSSIDLSFQMDTTTPLRTSEINNEVELVDSC
Download sequence
Identical sequences H2KYI7
NP_741736.2.50509 C14A11.3b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]