SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C35D10.9a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C35D10.9a
Domain Number 1 Region: 386-543
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.42e-101
Family CED-4 C-terminal domain-like 0.0000000318
Further Details:      
 
Domain Number 2 Region: 110-382
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.05e-44
Family Extended AAA-ATPase domain 0.000000000123
Further Details:      
 
Domain Number 3 Region: 1-107
Classification Level Classification E-value
Superfamily DEATH domain 3.03e-28
Family Caspase recruitment domain, CARD 0.000000939
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C35D10.9a   Gene: WBGene00000418   Transcript: C35D10.9a
Sequence length 549
Comment pep:known chromosome:WBcel235:III:4852325:4855180:1 gene:WBGene00000418 transcript:C35D10.9a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRI
YRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLL
LGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLI
GINYDSIVWLKDSGTAPKSTFDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALI
DRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYD
FLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQLNNKLESRGL
VGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMPPGVDIPVKLWSCVIPVDICS
NEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDHIIHMFLKHVVDAQTIANGISIL
EQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKTTEETVIRPEDFPKFMQLHQKFY
DSLKNFACC
Download sequence
Identical sequences C35D10.9a C35D10.9 2a5y_B 2a5y_C 3lqq_A 3lqq_B 3lqr_A 3lqr_B 4m9s_A 4m9s_B 4m9s_C 4m9s_D 4m9x_A 4m9x_B 4m9y_A 4m9y_B 4m9z_A 4m9z_B 4m9z_C 4m9z_D NP_001021202.1.50509 2a5yB C35D10.9a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]