SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C35D10.9b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C35D10.9b
Domain Number 1 Region: 408-565
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.77e-101
Family CED-4 C-terminal domain-like 0.0000000592
Further Details:      
 
Domain Number 2 Region: 110-404
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.88e-41
Family Extended AAA-ATPase domain 0.000000000546
Further Details:      
 
Domain Number 3 Region: 1-107
Classification Level Classification E-value
Superfamily DEATH domain 2.41e-28
Family Caspase recruitment domain, CARD 0.00000135
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C35D10.9b   Gene: WBGene00000418   Transcript: C35D10.9b
Sequence length 571
Comment pep:known chromosome:WBcel235:III:4852325:4855180:1 gene:WBGene00000418 transcript:C35D10.9b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTRLERIANFLRI
YRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDLLRPVVIAPQFSRQMLDRKLL
LGNVPKQMTCYIREYHVDRVIKKLDEMCDLDSFFLFLHGRAGSGKSVIASQALSKSDQLI
GINYDSIVWLKDSGTAPKSTFDLFTDILLMLARVVSDTDDSHSITDFINRVLSRSEDDLL
NFPSVEHVTSVVLKRMICNALIDRPNTLFVFDDVVQEETIRWAQELRLRCLVTTRDVEIS
NAASQTCEFIEVTSLEIDECYDFLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFK
SCEPKTFEKMAQLNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVV
MPPGVDIPVKLWSCVIPVDICSNEEEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKIDH
IIHMFLKHVVDAQTIANGISILEQRLLEIGNNNVSVPERHIPSHFQKFRRSSASEMYPKT
TEETVIRPEDFPKFMQLHQKFYDSLKNFACC
Download sequence
Identical sequences P30429
C35D10.9b C35D10.9b C35D10.9b NP_001021203.1.50509 6239.C35D10.9b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]