SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C48D1.2a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C48D1.2a
Domain Number 1 Region: 233-496
Classification Level Classification E-value
Superfamily Caspase-like 1.5e-78
Family Caspase catalytic domain 0.00000849
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily DEATH domain 1.65e-21
Family Caspase recruitment domain, CARD 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C48D1.2a   Gene: WBGene00000417   Transcript: C48D1.2a
Sequence length 503
Comment pep:known chromosome:WBcel235:IV:13198338:13204129:-1 gene:WBGene00000417 transcript:C48D1.2a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMRQDRRSLLERNIMMFSSHLKVDEILEVLIAKQVLNSDNGDMINSCGTVREKRREIVKA
VQRRGDVAFDAFYDALRSTGHEGLAEVLEPLARSVDSNAVEFECPMSPASHRRSRALSPA
GYTSPTRVHRDSVSSVSSFTSYQDIYSRARSRSRSRALHSSDRHNYSSPPVNAFPSQPSS
ANSSFTGCSSLGYSSSRNRSFSKASGPTQYIFHEEDMNFVDAPTISRVFDEKTMYRNFSS
PRGMCLIINNEHFEQMPTRNGTKADKDNLTNLFRCMGYTVICKDNLTGRGMLLTIRDFAK
HESHGDSAILVILSHGEENVIIGVDDIPISTHEIYDLLNAANAPRLANKPKIVFVQACRG
ERRDNGFPVLDSVDGVPAFLRRGWDNRDGPLFNFLGCVRPQVQQVWRKKPSQADILIAYA
TTAQYVSWRNSARGSWFIQAVCEVFSTHAKDMDVVELLTEVNKKVACGFQTSQGSNILKQ
MPEMTSRLLKKFYFWPEARNSAV
Download sequence
Identical sequences P42573
6239.C48D1.2 C48D1.2a C48D1.2a C48D1.2a NP_001255708.1.50509 C48D1.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]