SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F28E10.1g from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  F28E10.1g
Domain Number - Region: 70-125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0432
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F28E10.1g   Gene: WBGene00017900   Transcript: F28E10.1g
Sequence length 129
Comment pep:known chromosome:WBcel235:IV:4587382:4590297:1 gene:WBGene00017900 transcript:F28E10.1g gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLVGDTFSHSSSIDCISAHLKMNESIISIDRSLPQNESRSSNHAAAQNNANRNTQYIETS
LDRQIDAGRSEVQDIKSQLQKLNRLVNEMGVSGWEEELTRLRRENEQLRRELAERDATIA
ALQSQTVSS
Download sequence
Identical sequences U4PLE4
NP_001294241.1.50509 F28E10.1g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]