SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F55C7.7a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F55C7.7a
Domain Number 1 Region: 1803-1990
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.67e-44
Family DBL homology domain (DH-domain) 0.0000248
Further Details:      
 
Domain Number 2 Region: 1204-1387
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.95e-36
Family DBL homology domain (DH-domain) 0.0000312
Further Details:      
 
Domain Number 3 Region: 1998-2118
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-24
Family Pleckstrin-homology domain (PH domain) 0.0018
Further Details:      
 
Domain Number 4 Region: 1395-1510
Classification Level Classification E-value
Superfamily PH domain-like 8.7e-21
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 5 Region: 2305-2400
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000153
Family I set domains 0.0076
Further Details:      
 
Domain Number 6 Region: 2377-2479
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000941
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 7 Region: 456-600
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000123
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number 8 Region: 1572-1637
Classification Level Classification E-value
Superfamily SH3-domain 0.000000291
Family SH3-domain 0.005
Further Details:      
 
Domain Number 9 Region: 251-384
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000288
Family Spectrin repeat 0.0098
Further Details:      
 
Domain Number 10 Region: 801-937
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000036
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 11 Region: 14-174
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000484
Family CRAL/TRIO domain 0.018
Further Details:      
 
Weak hits

Sequence:  F55C7.7a
Domain Number - Region: 2192-2250
Classification Level Classification E-value
Superfamily SH3-domain 0.00415
Family SH3-domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: F55C7.7a   Gene: WBGene00006805   Transcript: F55C7.7a
Sequence length 2488
Comment pep:known chromosome:WBcel235:I:3999342:4031627:-1 gene:WBGene00006805 transcript:F55C7.7a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDYDGKMTMKAEDILHVLRDGIAVLPGGRCRAGQAVIVCPSREQPVNQDNLRNVFLYLF
EVTSKMAREKGFLVVIDMRGKQTWTNVRHILKALSSIESSSTVQVFIIKPEKFWEKQKAQ
MSLGTWDFEVEMISFESLIKIIDSSHLPKTVGGSYPYDHDEWLELRLDLEKWIWNITEIM
EKLESVRREICEGEQPVDVTTANAALKKSQHAKNSIFNVPVEGIETEGNKIATRILKPSK
GVKNPDLEATTPYISNLTDSLRLLKGEVAKNWEVRQMELSKVYQQKQFERDAEHMIETLR
PYKKACERSMGDVGGCANDVVRLSAEFEQFQIAVRGMEVSVKQVFDKENHLRTIGARNQI
TDHVAARLAEEWHLVKELMERRSAVLHNAKEFFTSAQRYFAEVPRWTAQPGVNPNDVLFN
QESLEEAIRKHDAFWAQVEEVYAQAYDDASKVTRALKEADAEDNVAREHSSRLQRAHKQL
MEKWKERQVLLHHMLAMIAFETDVRLVVDWLEQHGEPYLRRNIHIGENVNQARSFQRNHT
NFQRVAANTYGNVQKLHQVYQDVTKSGSKICDVDTMHGLMTDLSAKIEKFTKIENSRELL
LRQSVLFHTHYKELTDWYGKMGEKYKDRRIDLTVPTCDKNKERFVLETDETAQAYAMTID
EGKTLIEMMQRATRVFDVDYSASVAHIQLLISDIEDKNTQISSEWSPRRTLLHIASKFAM
FEQNQFEVLEQIKSWEVDMREMAESDSFYDKADSVLPFHKDNQQQVRNAIADIQKSAKEL
SQALYSQKLTDLRDKRDRVVLEAIREHVRELEIAESRVMTYANETSMRMQAASEVGDLRR
ISNSVCKLIDNQLSALTQLGVIPNDYNDTVQKQEELRAFRDAVQHKLKEPYDAFVIRFRE
LMENRLANRDEVVYHNEAIQAKYCRLMNLCEDRNKLLKSAHGCYKTYETAVLPILNQLES
EYHSPTVTDWCAGCTSSIDADRAAYVADLLSKHMDYKERFGKGCTYALRNGDFLLRYIRR
STVNQSERKRHETKIADMKNNIRERQSNILELWMQKKLLLEGCQSFIFIEASAKELLEFM
KGEGNRKLKHFEKKGRRESTDDDDEFAKFKSEVKQKKTDIQTFLMLSTNETMSRGVHGDE
IDRCIEQVKDEFSRFSRRVGDCEVVLRGENGSTQSSKDEFSLDRHSDTAIFNEKKINERR
EENRKMLEPMRELIQSERDYIKDLERCVNIYVKEFDQAAKNGTIPTLNPLKYEIFGNIEK
IFKFHNDKLLHELIKYENQPEAVGASFIVWIDLLNELYTEYCVNKEQKNHVIATPDAVSF
FTGIRERHGLEINNEIASLLIKPVQRITRYRLLIEQLMRSCTDKTNDLKEAYEVVCSVPR
KVNDLIHYNCLDLKDFKVDELGPFVTQDTLTFWEPRAYFKGRGKERQVFLFDISIVFAKR
IEVSPKNIKYVIKGKPLPLSEVSIVEHVEGDTCRFGLRVGTVSSNDNRIDLKANNHHTKV
KWVQKIRDLTAGMLPLGLGVSEAYSVGTLSTARSVSVRSGASTSSGGENRQSQDVESLLR
HRYSVHSCDSEQSSEVWIVTADFDGQVEGHLTVHKGDRVEIVEDQATDCAEYVQVVLCDQ
PTKHGLVPASIIAPPESGSVPDRPDDSNASGSTVSKRKSLRRIFANSSKERAAAANSSSS
NNNSPATRQSTSTSSPVTANGHTTESSTSAPIGVLSSGEPTSSNSIPSSSTPTHTVPSSV
PATVIPIVVAEDEKAEDCLPPPMENITINNSIDEKDMNEDSVAASDAVEPEVALPAKVEK
TPEETARFKRSYVLMELVETEQDYVKDLTSVVEGYIGNLNKMDLPADLVGKDKIIFANIV
NILEFHKTNFLKEIEKCSENYEAAGAAFVKYERRLHTLYVTYCQNKPKSDYLLAQDDFEA
FFADTKAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFTERAKDKTDTLKKALQVMHVV
PKACDDMMQVGRLQNFDKSLSAQGKLIHQGTLQISESIAGNVQKPKDRRIFLFEQSAIIA
DHIPPKKEFGNPTYIFKSQFMVNKMVFEPNVPDDPLRFVIKSSDPTQPTSFIANAQSQEE
KDEWNRKMSELLDQQKRLLAALVDPRRYNDMSSGMGDLSLGAPGGDRRGAPSSANRSAAS
SSKKPAESPKKEGKSKSSLFSFGKKPAKSPTSPPPLDAAAAGKFQKVADDQVNLETDEKV
KVLDVKNGYASVKKADGTVGKCPSYFLTMSDIPGTNFAEQIQYRREWQRRVDETDVEYGP
SAFDTATSSTDNFDVLLELTTCERPVVVEDMKDIEVVEGNDVEMCPIISSHTDFTVIWHG
PAVDSKRARIQTNQLNSRLLIKHVKKCDAGAYSVIAKNSFGVTSTVAFLSVISIPDPPTD
FTVKISGDHEVRLKWKAESGLKYCIEYRILDDSSPENWLIASTNIEKTHVSLRNFARNSY
SFRVFAYNQRVRSAPSQCICICFDGTEM
Download sequence
Identical sequences O61528
F55C7.7a 6239.F55C7.7a F55C7.7a NP_001021496.1.50509 F55C7.7g.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]