SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F55D12.2b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F55D12.2b
Domain Number 1 Region: 109-197
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000173
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 270-422
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000081
Family Spectrin repeat 0.0062
Further Details:      
 
Weak hits

Sequence:  F55D12.2b
Domain Number - Region: 2-44
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000445
Family CRAL/TRIO domain 0.0088
Further Details:      
 
Domain Number - Region: 394-515
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0504
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: F55D12.2b   Gene: WBGene00010111   Transcript: F55D12.2b
Sequence length 588
Comment pep:known chromosome:WBcel235:I:7891028:7894855:1 gene:WBGene00010111 transcript:F55D12.2b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKLSKFVDVNQLPEQFGGTLGYDPDSWLSKRIEIKKWQNYLVEVDADSSKHSLDDDQKL
EEFITKLQSTKRIEDEYASNILKKSVRDVKLKEEENSKEGLIKDHTAGVSDFLDWIEGSG
EKWLNSLCQVADNVDEAESLVKQHEELTNKTKEIEEQSHQLAEMATRLMAACPQVAIVLQ
KTREQIRDVAEHFAYRVEAQTQFAVSNRTFREKVAEFIKKSDLMLEKVCAEDGASVKTVE
ELTSTKKELDDLVNSMNVSFETAMDAGEETVAKARQYSEVLPAEEFVSHIGSSLTYISQR
QNRHNELASVKRLEQQQHLQLMTTYGDCDQAIKWLGELKETLHKEYSLSDIDEDAVKNLR
NDRQNLDRTAVSTYQYGKQLLSMAKNSERSAMKESSTDERKEKLETAWKELNLAIQNNEQ
RLKVVESFMATHRQMMERVNEIEKSLRERLRVSGKLNSIVLSTERKRLKNDIEELSNIGN
MLSAQINADHATTLQDRQTAVKQISDKINEVMTAQRRMESLIIEEEEAGSSSSGKEDKHS
SRKARPLSKVPEEEGGDVSPVFPRAVRLLETNEGIAPAIRLSKNESYL
Download sequence
Identical sequences C1P648
NP_001250624.1.50509 F55D12.2b F55D12.2b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]