SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for F56D1.6 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  F56D1.6
Domain Number 1 Region: 23-201
Classification Level Classification E-value
Superfamily EF-hand 1.53e-26
Family Calmodulin-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: F56D1.6   Gene: WBGene00023407   Transcript: F56D1.6
Sequence length 204
Comment pep:known chromosome:WBcel235:II:5447679:5448440:1 gene:WBGene00023407 transcript:F56D1.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVAKPTAAVSIEDLIKKHSDVDPFLVKKWERIFSLFFDRNASHQVDWGDFYLVVKKVRD
IYGAESVQTGFAKKSLAALWEGLCSIADADKDQLISIDEWIGLLKKTDAKTEPKWFKDYQ
NFMFKLFDVSCDGVMDLAEYTDGMSTYGFDQSECDAAFHKFSVDKKGQYVPQMKPETWNT
YFHQLFYSTNKSDVGNHLFGIIDF
Download sequence
Identical sequences Q10131
F56D1.6 6239.F56D1.6 F56D1.6 F56D1.6 F56D1.6 NP_495034.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]