SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K09B11.1a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K09B11.1a
Domain Number 1 Region: 171-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.69e-68
Family Protein kinases, catalytic subunit 0.00022
Further Details:      
 
Domain Number 2 Region: 8-107
Classification Level Classification E-value
Superfamily DEATH domain 1.22e-22
Family DEATH domain, DD 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: K09B11.1a   Gene: WBGene00004029   Transcript: K09B11.1a
Sequence length 485
Comment pep:known chromosome:WBcel235:IV:13416792:13421525:1 gene:WBGene00004029 transcript:K09B11.1a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDSLGVSEVVMIPFMKREVLQQICAILDTDNTWETIAPYMPGIELRDVEGCKRYSSYNQ
SPSELLLRIWSSKGYSTTHLYQLFAKTKLIRLMRMMRSQVHEKYHYLENKVTNSTSRVSK
QMVQPPGSQSASRLKKTEIKESSPSPAAAAASQLSRSNTDDTLRVAIEGTLPVTYCELLE
ATNGFAVSNVIGKGGYGTVYKGELKGTGGIVAVKRLHSGNDTSQNGSRERLRQSLTELRT
LARFRHDNILPIYAYSLEGSEPCLVYQFMSNGSLEDRLLCRKGSVPLTWIQRKEISIGAG
RGLGFLHSFGKTPIIHGDIKTANILLDKHMEPKIGDFGLCRDGHVEAEAMEKHPLIASHI
KGTLAYLAPEFITSKILTTKLDVYSFGIVLLEIASGQRAYSDSRETRGLVEYCQVNKELA
AHRKIPVREIFIDRRAPPLVGDEEKSFLDALIEVGLAGANNDRKVRPTMSQIVEYLCKNS
IPPVV
Download sequence
Identical sequences G5ECP4
K09B11.1a NP_001255742.1.50509 6239.K09B11.1 K09B11.1 K09B11.1 K09B11.1a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]