SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K10B3.10a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K10B3.10a
Domain Number 1 Region: 118-268
Classification Level Classification E-value
Superfamily Spectrin repeat 6.41e-35
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 2 Region: 644-798
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-35
Family Spectrin repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 749-905
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-34
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 4 Region: 538-691
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-32
Family Spectrin repeat 0.0000753
Further Details:      
 
Domain Number 5 Region: 221-375
Classification Level Classification E-value
Superfamily Spectrin repeat 6.81e-32
Family Spectrin repeat 0.00053
Further Details:      
 
Domain Number 6 Region: 1355-1505
Classification Level Classification E-value
Superfamily Spectrin repeat 4.84e-31
Family Spectrin repeat 0.0000268
Further Details:      
 
Domain Number 7 Region: 1246-1383
Classification Level Classification E-value
Superfamily Spectrin repeat 3.3e-30
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 8 Region: 1458-1611
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-29
Family Spectrin repeat 0.00017
Further Details:      
 
Domain Number 9 Region: 1885-2039
Classification Level Classification E-value
Superfamily Spectrin repeat 3.01e-28
Family Spectrin repeat 0.00075
Further Details:      
 
Domain Number 10 Region: 331-480
Classification Level Classification E-value
Superfamily Spectrin repeat 7.98e-28
Family Spectrin repeat 0.0009
Further Details:      
 
Domain Number 11 Region: 1775-1920
Classification Level Classification E-value
Superfamily Spectrin repeat 1.17e-27
Family Spectrin repeat 0.00016
Further Details:      
 
Domain Number 12 Region: 1582-1717
Classification Level Classification E-value
Superfamily Spectrin repeat 9.12e-27
Family Spectrin repeat 0.0000366
Further Details:      
 
Domain Number 13 Region: 29-157
Classification Level Classification E-value
Superfamily Spectrin repeat 3.22e-26
Family Spectrin repeat 0.0000527
Further Details:      
 
Domain Number 14 Region: 1160-1262
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-23
Family Spectrin repeat 0.00099
Further Details:      
 
Domain Number 15 Region: 2045-2159
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-23
Family Spectrin repeat 0.00021
Further Details:      
 
Domain Number 16 Region: 2263-2424
Classification Level Classification E-value
Superfamily EF-hand 1.68e-22
Family Calmodulin-like 0.012
Further Details:      
 
Domain Number 17 Region: 1079-1195
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-20
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 18 Region: 982-1050
Classification Level Classification E-value
Superfamily SH3-domain 4.86e-20
Family SH3-domain 0.0000649
Further Details:      
 
Domain Number 19 Region: 909-972,1045-1084
Classification Level Classification E-value
Superfamily Spectrin repeat 2.66e-18
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 20 Region: 2161-2270
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-16
Family Spectrin repeat 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: K10B3.10a   Gene: WBGene00004951   Transcript: K10B3.10a
Sequence length 2427
Comment pep:known chromosome:WBcel235:X:3117455:3127073:-1 gene:WBGene00004951 transcript:K10B3.10a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSNDTHAPPEPVLEVPPPQEIRILETADDIHQRRQEVLGHYSIFKDHSQTKRDRLEEA
RQFQYFKRDADELNVWILEKLQTAQEENFRDPSNLQAKIQKHEAFEAEVQAHAKTIANLD
KTGNAMIQHNHFASEHIKKRLEELHALWDKLFFKLKDKGIKLQQALKLLHFIRQCDEILY
WIREKETYVTAEDMGMDLEHVEILQRKFDDFLKELGNHQYRINEINQAADKLVEEGHSEH
DQIYKKRDDVNDAWHRLNTLAATRKEGLFGAHQVQRFNRDADETLAWIGEKDLALSSDDY
GRDLNNVQALQRKHEGTERDLAALEGKMLQLEKEAHKLAETHPDRAEAIHQKNDDTKAAW
NALKEKAQHRKDGLERSFQLHRFLADYRDLISWIGDMKAVIGADELAKDVAGAEALLESH
QEHKGEIDARADSFNQTASAGQKLVEMGIPESPEVQEKLEKLDHEKSSLLGLWEERRILY
EQCMDLQLFYRDTEQAETWMNKQEAFLANTDLGDSLDSVEHLIKKHEDFEKSLAAQEEKI
NALDEFATKLIQGQHYAADDVAERRQALLDRRRRLLDRARQRGNALKESYKRQTFDRDCD
EMVSWITEKLSTARDDSYLDPTNIRGKLQKHINFEQELKANENRLDDIRSTGEQIIDSGH
FAADHIGDRLRQVNNLWNELVDATNKKGAKLREAGNEQQFNRNIEDVEAWLSELEGQVAS
EDYGKDLVSVQNLQKKIGLIESDFNAHNDRVDGIKQLAQQFQEEEHFNAPVIVRKQENLQ
QRYNALRDPLEKRKRKLGESHQGNQLFRDIEDELAWIREKEQVAGSTNRGRDLIGVQNLI
KKQQALIAEIANHDSQIESVSSAANDMIQQGHFLAPEIRDKLAQLRDNWRILKSKAEKRR
TDLDDSLQAHQYLSDANEADAWMSEKEPIVGSTDYGKDEDSAEALLKKHRALLSDLEAFK
GTIEDLRKQASQCKYQEQPMGQLGRDCVLALYDYQEKSPREVSMKKGDVLTLLNASNRDW
WKVEVNDRQGFVPAAYVKRIEPGTAQQHAQQQVNSIGGKQSEIEDKYQRLMMLGETRKRK
LEEACKGYQLLREANDLAEWIKSREAVAAQQEIGTDLEQVEVLQKKFDDFKGDLKANEVR
LQEMNQIATALTSVGQTETAVRIRQQIEDLNARWRALEEQTEQREQQLGSAHEVQRFHRD
VDETRDWIQEKDDALDSEDFGRDLRSVQALQRKHEGVERDLAALGDKIKSLDEKANRLRQ
SHPEAAEQIYDLQRELNEQWNRLTSKANNRKEKLLDSYDYQRFLSDYRDLMQWIASMNQL
VSSQELANDVTGAEALLERHQEYRTEIDSRAATFQAFDQFGNQLLNSHHYAAGDIENRLQ
GVNEARKGLEDAWVARRNILDQCLELQLFYRDCEQADTWMSAREAFLAQEDPSGDNVESL
IKKHEDFDKAINTQEEKIKGLKLFAESLIKNNHYDSPAVTRKRDQILDRWNGLKEALIQK
RFKLGESQTLQQFSRDADEIENWMTEKFQIAQEENYRDPTNIQQKHQKQQAFEAELHANS
DRIAAIIQAGNNLIENAKCGGGEAAVSARLKALNDQWDLLVKTTTEKSYRLKEANKQKSF
MAAVKDLEFWLGEVEILLQSEDYGKDLASVENLLKKHSLLEADIVAHQDRVGEMNEQADS
LLENDQFQGQQIAERRKLIADRYDGVKKMATDRRDKLSKALNVHQFFRDIDDEESWIKEK
KLLVSSDDYGRDLPGVQNLRRKHRRIDTELASHEPQVSLVKLKGEELLRSAAEAGVGEDQ
IKKRMEDLEQSWGQIRDLTGNRHQRLDESEAFQAFLGDVEEEEAWMNEKQQILGSDNFGE
NMAGVQGLLKKHDTFQVDLELHKQRVADLINKGDTLIHNGNHHAPHIKQRCDQLRARLIE
IESMAEGRLAKLRDNSAYLQFMWKCDVVESWIAEKEQQVRSEDFGRDLSSVQILLTKQEA
FDAGLNAFEHEGIQRITELKDQLVSSEHQQSPAIEKRHTNVIQRWQNLLAHSEARRQKLL
KMQQQFKQIEELYLAFAKKASTFNSWFENAEEDLTDPVRCNSLEEIRALRDAHGEFQRSL
SSAEEDFRQLQDLDRRIKSFNVGPNPYTWFTMDALEDTWRNLQRIIKEREQELAREHQRQ
EENDKLRREFAKLANAFHAWLTNTRQEMMEAGGTLEEQLDAVERKAKEIKANKGQLRQIE
EKGAMLERNLILDNRYTEHSTVGIAQAWDQLDQLAMRMQHNLEQQIQARNQSGVSEEALR
EFSMMFKHFDKEKTGRLDHQQFKSCLRALGYDLPMVDEGQPEPEFQRILDIVDPNRDGYV
TLQEYMAFMISKETENIQSSEEIEMAFRALSKEFRPYVTAEELYANLTPEQAEFCIRRMK
PYMDAISGRSIQGGLDYEQFVHALFQS
Download sequence
Identical sequences G4S034
6239.K10B3.10 K10B3.10 NP_001256999.1.50509 K10B3.10a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]