SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K11C4.3a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K11C4.3a
Domain Number 1 Region: 24-262
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.82e-87
Family Calponin-homology domain, CH-domain 0.00000376
Further Details:      
 
Domain Number 2 Region: 281-402
Classification Level Classification E-value
Superfamily Spectrin repeat 1.1e-32
Family Spectrin repeat 0.0000666
Further Details:      
 
Domain Number 3 Region: 2117-2228
Classification Level Classification E-value
Superfamily PH domain-like 2.14e-29
Family Pleckstrin-homology domain (PH domain) 0.00023
Further Details:      
 
Domain Number 4 Region: 1530-1675
Classification Level Classification E-value
Superfamily Spectrin repeat 3.36e-27
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 5 Region: 1213-1366
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-27
Family Spectrin repeat 0.00045
Further Details:      
 
Domain Number 6 Region: 1001-1156
Classification Level Classification E-value
Superfamily Spectrin repeat 5.28e-27
Family Spectrin repeat 0.0000227
Further Details:      
 
Domain Number 7 Region: 1871-2004
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-26
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 8 Region: 1436-1578
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 9 Region: 594-730
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-24
Family Spectrin repeat 0.0005
Further Details:      
 
Domain Number 10 Region: 807-942
Classification Level Classification E-value
Superfamily Spectrin repeat 4.08e-24
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 11 Region: 1743-1897
Classification Level Classification E-value
Superfamily Spectrin repeat 4.39e-23
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 12 Region: 412-511
Classification Level Classification E-value
Superfamily Spectrin repeat 1.07e-22
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 13 Region: 735-838
Classification Level Classification E-value
Superfamily Spectrin repeat 2.49e-17
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 14 Region: 516-626
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-16
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 15 Region: 2008-2076
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000183
Family Spectrin repeat 0.002
Further Details:      
 
Weak hits

Sequence:  K11C4.3a
Domain Number - Region: 1164-1215
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0676
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: K11C4.3a   Gene: WBGene00006803   Transcript: K11C4.3a
Sequence length 2257
Comment pep:known chromosome:WBcel235:V:6881344:6891403:1 gene:WBGene00006803 transcript:K11C4.3a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVDGNSGAYTQDEDYDDNSSARLFERSRIKALADERELVQKKTFTKWVNSHLVRVSCK
VQDLYMDMRDGKMLLRLLAVLSGERLPKPTPGKMRIHCLENVEKGLQFLRNQHVHLENLG
SHDIVDGNSRLTLGLIWTIILRFQIQDITFEDADNHETRSAKEALLLWCQMKTAGYPNVN
VKNFSTSWRDGLAFNALIHKHRPDLVDYDNLQKSNALYNLQSAFDTAENQLGLAKFLDAE
DVNVDQPDEKSIITYVVTYYHYFNKLKQDNIQGKRIGKVINELMENDKMINRYETLSSDL
LEWINAKIQLLNERHFENNLEGVQRQLTEFNDYRTQEKPPKFDEKGELEVLLFTLQSAMR
ANNQRPFVPREGKLIADINRAWQSLEKAEHERELVLKEELIRQEKLEQLAARFNRKAEMR
ETWLTENQRLVSQDNFGNDLSSVEAATKKHEAIETDIFAYEERVQAVVAVAGELEAENYH
DQAKINERKENVLQLWNYLFQLLLARRVRLELSMAIQKIFHDMLLTLDLMDDIKSRLLSE
DLGAHLMDVEDLLQKHALLESDINIIGERVNNSIAQAQRFRNPDGPDGSGYKPVEPGTID
ERSDVLQKRYKELLDLAAERKRRLEDNKRLCQFWWDVAELEHGIKEQEQVLSSTDTGRDI
VTVSHLLAKHKNAENNLRDLEKYLDRLDVSGKELQDESIPGSDNIPPRLAEIRDYINKLK
ELSASRKERLAGGVEYYQFFTDADDVDRYLYDTLRVMSSEDVGKDEGTVQLLLKKHDDVH
DELQNFDQHIKVLHAKAESLPQEAREHPDIRQRLDTTLKQKAELENLSQLRKQRLIDALS
LYKLYSDADSVESWIDEKGKLLATLVPGRDIEEVEIMKHRFDTLEQDMKNQEAKVTNVND
LARQLLNVEHPNSDDILHRQNKLNARWAQLRDMVDQKRNELERAHRLETFRIDCQETVTW
IEDKTRVLEDSDALTNDLSGVMKLQRRLSMMERDLGAIQAKLDSLHKEADDIERERPQEA
QAIREDIKRIHQVWDILNKKVREHEAKLDEAGDLQRFLRDLDHFQAWLTATQRQVASEEE
PQSLAEAEQLLNQHAAIREEIDGYAEDYKKMRAMGDRVTQDQTDPQYMFLRQRLAGLQEG
WEELQRMWDNRQHLLSQGLNLQMFLRDAKQAEVMLSQQENYLAKDDIPQSLEQAENQLKR
HQDFITTMDANDEKIRAVGMFGDQLCQDGHYAADKIHKKARNIDERRGANREKAQEVLKK
LKDALSLQQFLSDCDELREWIEEKMIRAQDETYRDAKTITSKFVRHQAFQSELAANKERL
DQLKHAAINLGDDKPEYHGTIDPQIEELATQWDELEKTTEEKGQKLFDANRQQLYVQSIA
DMKEWATQLENEMTREDQPGDLTTVNVAMQKQHLIETEMIKKAQHIDQLMEMEPQLEELH
PDELENIKAHRLAVQEQLQRLQAPLDDRRKALERKKAAFQFGRDVDDEKLWISERLVLAK
AQNLGESLPDCHRLQKNLQLLSNEIDNHEPWINQICNNGQELIDEGHANGPAFEKKIQEL
RSAWQELKEAVKDRKGDLGESEKAHQFLYDCGEAEAWMSEQELYMMQDERGKDEFSTKNQ
IKKHERLQSDIDKFADTIRALATKAHKFVEEKSPLTEQIQVRQAQIEKLYAGLQDLSKER
RKRLEETLELYALHREIDDLLQWIADKEVVAGSQENGQDYEHVQMLQERFQQFARDTENI
GSERVANANDGCDTLIGHGHTDAPTIALWKDSLNEAWENLLELMDTRAQILEASRLLHKF
YHDCRDCLSRIMEKTHAMPDDLGRDSSSVGALSRKHQNYLKDIAAIGEQVAQIERDAAEL
RDGYAGDKALDIGSRESEVVKAWRHLRGLCDARTSRLMDTSDLFKFMNMVRDLLLWMDEV
KREMNSQERPKDVSGVELLMNNHQSLKAEIDAREENFNACISLGRDLLNRKHYASSEIEK
KLIKLTTERAEMMRRWEDRWEYLQLILEVYQFARDAAVAESWLFAQEPYLISKEYGRNLE
ETIKLIKKHEAFEKSAFAQEERFLALEKLTTFELKETQHREEETAKRRGPAHIGSPSRST
PAAETSFGAQDDGAKQGEAFEGTLIRKHTYESLDRKAANRSWEKLYAVLRQNELSFYKDP
KHRDESVHGEPPMALPGCSVNVASDYQKKKNVLSLRLPIGAEYLFQCGSEEDMQRWLTEL
QVATGQAQLEEASRSQTLPAEGSATKKKGGFFSRGKK
Download sequence
Identical sequences G5EG85
K11C4.3a K11C4.3a NP_001024052.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]