SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for K12C11.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  K12C11.4
Domain Number 1 Region: 9-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.15e-80
Family Protein kinases, catalytic subunit 0.000000113
Further Details:      
 
Domain Number 2 Region: 390-676
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.63e-59
Family Ankyrin repeat 0.0000434
Further Details:      
 
Domain Number 3 Region: 1298-1386
Classification Level Classification E-value
Superfamily DEATH domain 1.09e-16
Family DEATH domain, DD 0.0051
Further Details:      
 
Domain Number 4 Region: 698-723,779-851
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000263
Family G proteins 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: K12C11.4   Gene: WBGene00003400   Transcript: K12C11.4
Sequence length 1425
Comment pep:known chromosome:WBcel235:I:1305575:1328228:1 gene:WBGene00003400 transcript:K12C11.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDDVNSSATSTSSSTVHFDDTPFEDVYEIETELGSGQFAVVRRVRDRKTGEKYAAKFIK
KRRYATSRRGVTRQNIEREVRVLQKIRGNSNVVELHAVYETASDVIIVLELVSGGELFDH
VCAKECLDEVEAAAFIKQILLAVRHLHSLHIVHLDIKPENVMLKQRGDSQIKIIDFGLSR
EIEPGAVVKDMVGTPEFVAPEVVNYEALSPATDMWAVGVVTYILLSGGSPFLGDNRDETF
SNITRVRYHFSDRYFKNTSKHAKDFIYRLFVRDVDQRATVEECLQHPWIRGPEGNAIDIR
KASCITISHIQSFKTRQRWKRCVELVMVLLKASKSSRRIGDGRFDEEDMVASCTLICAEE
GNLRALHKLSALHKLLPNATRKSLKSSFSEPNGATAMHCAAKYGHAEVFNYFHMKGGNIC
ARDDNGDTPLHVACRFAQHTVAGYVANEKIDVDSINKTGETALHCAVESADTRVVRLLLQ
LRPRLDLPNASGDTVLHLAADSINPRIVPLLVCLAPPLHLRNIREETPLHVAAARGHVDC
VQALLDANSPIDAVEQDGKTALIIALENGNVDIASILITNGCDINHADHHGDTALHIASK
HGLLQAVQTLCHCAVTVDSVNANKKTALHLAAHYGHVDIIRVLLLARADVTLRGDDGLTA
ELVAVAAERLEAHSLLKMVKSQEIREEYISQLYPLDTSLRRIKLKLLGHSQSGKTRLVQT
LHSSRGISSFLESVTRRISDHYSPSSSMKDDGIHSTNGSFVSESNNNSSFDLAAAAGSKY
APPHSQYTRGIDVQTVNINGCGEFSVWEFGGYEPMHTCYDHFVGNADCIHLILYRTSDPT
EVQYKQILYWMNFLKGRVTPFEPIGHCGFSSRRSKVIIVGTHATSSLFPQMNQEGEYVSS
DIEAMLNTVRLRFETHFDMDHRLILLDATNPSCIGMKTLKMELAKCRTNILAKLLKPLAI
LDTVVNHLNLVRKKHANFPVITWPDFIQLVRNEINPLTGDAHCRQIVQQLQLIGELVYLR
NDLCDADYVVLNAEWFGTHILGQLLSAEFLSKASPNGSYHTSSLAKIFPEIPEQSDLMTI
LEVLQLCAPDARTGAHEFPVFIQTEAPDSIWRPYSLKEKERDTVYGGVRILPMRGMERSL
HSTFPRIQVALRRSINDYQPAKDTQLHQWSECSKLVSQDREAVIRMVGDAVEIRARGPSE
SATSMFYFMEDLINLVEHAAAEVGPGISLERHFISPKHLKEHREHPALFPPESMMEMQQR
ESLSVKGTQDEEELFTDVVCFGSRDVARHLTLGIDVGVADLQMASRCELACLLDPPHAMG
RDWSILAVKLQLTDQVPDVDSTGQSLSRTDQLLNEWAIHHPEQASVGNLCRILVELGRCD
ARDALYRTVPLYVFAPLEDQFLLETNDSGVVSSCHSSSEHNPINI
Download sequence
Identical sequences O44997
K12C11.4 K12C11.4 NP_490840.2.50509 K12C11.4 6239.K12C11.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]