SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for M116.5 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  M116.5
Domain Number 1 Region: 23-282
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.85e-77
Family Calponin-homology domain, CH-domain 0.0000188
Further Details:      
 
Domain Number 2 Region: 487-657
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000000188
Family Calponin-homology domain, CH-domain 0.00085
Further Details:      
 
Domain Number 3 Region: 878-936
Classification Level Classification E-value
Superfamily GAS2 domain-like 0.000000000000615
Family GAS2 domain 0.0019
Further Details:      
 
Domain Number 4 Region: 302-471
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000425
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Weak hits

Sequence:  M116.5
Domain Number - Region: 671-780
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0207
Family Spectrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: M116.5   Gene: WBGene00019792   Transcript: M116.5
Sequence length 1083
Comment pep:known chromosome:WBcel235:IV:8414293:8421063:-1 gene:WBGene00019792 transcript:M116.5 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGEKNRSQHKIDPSDAQEKDILDHYELNRGKFNDVRDTMQKKTFTKWVNKHLTKTDHTI
VDLFVDLRDGFALIALLEALTGERIQRENGYTRFHRIQNVQYCLDFLKMKNIKLVNIRPE
DIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQTNEKHTTNSQDSIHRSETTSA
RDALLQWAKRTTAEYPRGNVINFSNSWRDGLAFNAIIHRYRSSAIDWNKINSDSVSNTER
LNIAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPQEPEMSKFAASGGKR
LEEEIGKLQADADHIFEALAVISKDEALQESPSLLLVSKQVSKKIEQLKVLLKLVEEKKD
TFISKCKLVMRTAGPESDAKELDSLMKHVEDAYSDVFELISDKEGLIDRCNASNINSDSV
PNTESLNLAFAAADPEFGAGRLLDAEDVDTNNNPDEKPVITYVSSLKNAPQDPEMSRLAA
SGGKGFEEEIGKLQADADHIFEALAVMSKDEALQESPSLLLYSKQIRFNKIQKLKELLKP
VEEKKDTFISECKLVMKTAGPEADTKELDSLLKQVEDAYSDVFELISDKEGLIDRCNASN
INSDSVSNTERLNIALAAADAEFGAGRLLDAEDVDTNNNPDEKSIITYVSSLNNAFPLEP
EMSKYVASGGKRLEEEIGKLQADADHIFKALEEISKDEALQESPSLLLDSKQVSKKIEQL
KVLLKPVEEKKDTFISESKLVMKTVGPESDAKELDSLMKHVEDAYSDVVELISDKEGLID
RCNASNRIAHPQTETEKITNEIELLKETCSCCTPYQIEKISENYYRRSKSNFRGYYFSKK
QSKKQCFFFSKIRIIKNFMTAQNFKKKILLKSQSLSSFSCLSMGRKLFFFGDTHIKRMVR
ILRSTVMVRVGGGWEPLEESLQKHDPCRTKGRLNINMFPEARPIHALDLMQSFTKNRHAK
QMPIAGTPGPIMKIREKTERSVPMSGGLGGTAGYTVTTESPRKTPQRPFRIPRTPSDKTP
GRQSRVGCVSNLKNSIVEPSSPSQSESRASPEVADRQKRISLSLKEKGKRYSPQVGPSSS
TPK
Download sequence
Identical sequences M116.5 M116.5 M116.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]