SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for R31.1d from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  R31.1d
Domain Number 1 Region: 33-273
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.16e-84
Family Calponin-homology domain, CH-domain 0.0000113
Further Details:      
 
Domain Number 2 Region: 3659-3787
Classification Level Classification E-value
Superfamily PH domain-like 1.6e-32
Family Pleckstrin-homology domain (PH domain) 0.00089
Further Details:      
 
Domain Number 3 Region: 298-414
Classification Level Classification E-value
Superfamily Spectrin repeat 4.06e-29
Family Spectrin repeat 0.00014
Further Details:      
 
Domain Number 4 Region: 1509-1660
Classification Level Classification E-value
Superfamily Spectrin repeat 1.08e-27
Family Spectrin repeat 0.00067
Further Details:      
 
Domain Number 5 Region: 1298-1450
Classification Level Classification E-value
Superfamily Spectrin repeat 2.64e-27
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 6 Region: 2676-2829
Classification Level Classification E-value
Superfamily Spectrin repeat 1.96e-24
Family Spectrin repeat 0.00029
Further Details:      
 
Domain Number 7 Region: 3316-3470
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-24
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 8 Region: 1875-1989
Classification Level Classification E-value
Superfamily Spectrin repeat 5.88e-23
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 9 Region: 2996-3147
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-23
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 10 Region: 3149-3262
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-22
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 11 Region: 1731-1874
Classification Level Classification E-value
Superfamily Spectrin repeat 1.51e-22
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 12 Region: 701-810
Classification Level Classification E-value
Superfamily Spectrin repeat 3.84e-22
Family Spectrin repeat 0.0011
Further Details:      
 
Domain Number 13 Region: 2571-2726
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-20
Family Spectrin repeat 0.0016
Further Details:      
 
Domain Number 14 Region: 1207-1343
Classification Level Classification E-value
Superfamily Spectrin repeat 1.83e-19
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 15 Region: 2411-2514
Classification Level Classification E-value
Superfamily Spectrin repeat 3.24e-19
Family Spectrin repeat 0.001
Further Details:      
 
Domain Number 16 Region: 494-629
Classification Level Classification E-value
Superfamily Spectrin repeat 9.93e-19
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 17 Region: 2893-3032
Classification Level Classification E-value
Superfamily Spectrin repeat 5.85e-18
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 18 Region: 416-527
Classification Level Classification E-value
Superfamily Spectrin repeat 6.02e-18
Family Spectrin repeat 0.00037
Further Details:      
 
Domain Number 19 Region: 2042-2169
Classification Level Classification E-value
Superfamily Spectrin repeat 1.3e-17
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 20 Region: 2300-2415
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-17
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 21 Region: 2148-2269
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-16
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 22 Region: 1084-1209
Classification Level Classification E-value
Superfamily Spectrin repeat 4.47e-16
Family Spectrin repeat 0.0035
Further Details:      
 
Domain Number 23 Region: 937-1036
Classification Level Classification E-value
Superfamily Spectrin repeat 8.88e-16
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 24 Region: 2810-2900
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000403
Family Spectrin repeat 0.0019
Further Details:      
 
Domain Number 25 Region: 634-736
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000288
Family Spectrin repeat 0.00097
Further Details:      
 
Domain Number 26 Region: 824-888
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000131
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: R31.1d   Gene: WBGene00004855   Transcript: R31.1d
Sequence length 3953
Comment pep:known chromosome:WBcel235:V:11901108:11916610:1 gene:WBGene00004855 transcript:R31.1d gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKYEMQVRVPTSGAPPVRADANGTDQDEFNNETLYFERSRIRTLQDERVHIQKKTFTKW
CNSFLNRASLEIVDLFEDVGDGIMLMKLLEIISGDKLGKPNRGRMRVQKVENLNKVLDFL
KKKKIQLENIGAEDILDRNERLILGLIWTIILRFQIDTIVIEDEEERGERKHAKDALLLW
CQRKTAGYPNVRIENFTTSWRNGLAFNALIHSHRPDLVDFNRLNPNEHVDNLNHAFDVAE
KKLEIARLLDAEDVDVTRPDEKSIITYVSLYYHHFAKQKTEMTGARRIANIVGKLMVSET
MEDDYEHIASELLNWIRVTIKTLESRRFPNSLNGMREEHAKFNQFRTSEKPPKYKEKGEL
EALFFTIQTKRKAMSRKQYQPPQGLFMHDIESAWAQLDYAENERQVAIIAELQRQEKLEQ
LAQRFHKKAKLRDSWLRSVQVVLEEMEHGRSASQVEKTLKKQQAISTDILAREDRFKMLT
AMCNELCTEKYHESDKVRGMEREIIDRWTQLLTLLEQRKRALMSLNDLMSLLRDIDTLSN
ELYSLEPAVRNRDVGKHLIGVEDLLGKHDLLDAQINAHGSLLSKLSQSANNYIRHKEEQF
DVLQRKLDEVTAQYNTLVELCRSRRLGLERARSLFQFVQDHEEEMAWLAEKEKLCTTALN
SGDISAVPQTTLLYKNVEMEMQTHWARSKGMIAGGERLVQNGQSKEDIQRRLTQMNHRWE
RLRVAVDALGNWLSEARHAQQYFQDANEAESWIREKMPLVKSDDLGRDEGAAESLLQRHA
RLEEEIRAYKSDISRLEEMQSQLANSAFHTATTSQSVQETEEVNVPQVEMSYNYEGNGMR
VSKGEVLALLEKSTPEWWRALKRDGTEGYVPANYCKIVPGETVTVTQTTQKTTTTLEGNE
TKSSVVADRQHKISNDYRELKRLADVRRRLLSDNIKLLRFYRECDEFERWAKEIEVSLAD
EPSPEHVAAFRRKFDKLEADMKTNGGTQLKHINDIANDLISEGHGQSRKIEVRQHKINAM
WDNLERLRKQRGVRLEATERVADFDTTCESAREWMLSKFEQLDRNPNDVKSLQNLERDLK
PLEDKIAALEKLAAAVKKDHPEEAAAIERKIAELRALHADLLRRAQEKMLLAEQTQGKEM
FESALRDMIGWIEKTRKVMMEDVHPVDVAEAEELLKKHYELGEQIKDKKYEVEYCQELGR
RLLERNPRMSKVEEQLQNLVSEMASLRDLYRRRDTILKQQLDLQLFNRESERIDAATKGH
EAFLEFDNLGDSVESVENLLKRHRDLEAKLDAQEARLEAFSRTADDMIKAQHADSAYIEQ
RRRDVLARREAVRRAAAQRKKQLEASLEYQEMRREADEVVGWMYEKAKLVMSGDDSALAP
SAIPHRLLKHEAFEAEIIANEPRIQQINSEGDGLVSKKHYESPNVEKIVRQVNAQWGDLK
KQVWNKGLRLRQAADQKGLDRILEDAHAKLDEMQTALNSKDQGLDLRSVKDLLQKHAVLE
QEMGLYGNKLSDIENRGKKMAVDGHYDADRIHSTVGQLLQRYAAMKGPAQRRKGDLDESR
LWHQLVFDVDCELQWIAEKKPIASSQDCGRTLTEALNMVKKQEQLEAEVNQHGGQIDKVL
LQAGELIKRHHSASSQIKAKSSELETAWSELKKLLRLRRAVVDWGVKEQQYLFDAAEVES
WMNEKRNALASEDYGNDEDAARKLLSKHRALCEDMTTYRQWLEKLEVKCVELVESNRPHV
ERFQKRQDELVREFDALSKLAEDRRNALEDAVCLYEYMRESADLGQSIEENLRVAMSEEF
AEDYEHLKELQSKFDEFKQKVKNGSERFTSCETAANAILRRNPPFARDVVKKQEALRTAW
NTLCEYIEARDSKLAVAEELHRFHRDVDEFEQWMADKMANMPRDLGRDVKHVHSLWQHHE
ALDKEIHNSQPRLAKLVEEAERLKKTYPGGNAEQIGGRQQTLEQEWEELKNATDDRKDML
RAAFDLHTFNGKVRDLLAWTDLTISDIQSDLHINDLQQAEWLQTEHSRLSHEMDAREPEF
ARLVNDGEKMITAQHYASEEIKNKTHLLKSALERLRSEWALRNGFLSQAVQWHAFQREAK
QIIASIGSKRTTLRSLAVGGSVADVESQTKRLDTFEKALSTLDERTATLDHTANELMKAR
HMESKNISMWQSNVHEELKLLRQDIEARHAMLKDAFALASFDSDVAQIEAWIDEKTNGVR
KAQDLSSESISIDEKMKRLQTHQALEAEVTANKPVVDQILQRGNQLKNLHRNPKIANRCD
ELSYKWNQLSGACADQSLALEEARDLLRFKQLVENVLAWINEKEVLVSTADMGKDMEHCR
LLLERLDGTRSDSIVDEQTLDEINRLGEKLVKQGRSSRDQVQKEQQHLNEKWRLLLGQLA
HYRTELLAAMEVHTFNRDVEDTDERIHEKVAAMKSDDYGKDFASVELLVRKQSALERDMS
AIHQKLIAHDKDAQKILEKRPPLRETVLDSLKKLEESWEQLSKAAELRNEKLNRSFKLYK
YLDDVKKVEQWANQVRNKMTSHQTPKDSNGARKILEQHHERKAEIDGRSEELRLLHEEGQ
ALNQEQPEHKAEVQRAHKRVQNSEHQLRQTWESEKGTLQKLLEWMLWCDEAVQCEQWLSD
KETQVARGELGDTTDAVEMLIKGHSAFEETVRKQSEKIDALTKNADALVSGGNNYRADIV
TRSEEVTARHALLLKSMEKRGHMLEDSKKYHEFIRQCGELIIWITAKLQLAYDESFLDHT
NLRSKLQKHMAFDSELVENEKRLSTVERQGEQLVTDNHFMSEQVKAQLVELRSGWDELRT
KSALKTQRLREAFELHSLQRKVEDIEKWLDKVEGELSSDDHGRDILSTELLIKKLDTLQT
EIAGRSDAVVEMMKKARELRVQGSAAADDCLKQAEQVEARYSGLDEPVQIRRENLVDAQA
FFQWVKAAEEDLEWLSDRMMLASSGESGDSLQSALSLQKKHATLEKELDTRQSAMNDTEQ
RGKDMIRQRHFASTHIQKILDRLSSAMLTLKESCGLRRDLLQEAIDAHEYYTEETEAEQW
LREQMPLAMSQEMGRDQAGAESHLRRLTVLDKEVELFKNEIDRLKKRADGLLAREHHDAM
SIAAKQRKLEALFGDLCRECARRRTQIVDASKYHKFVRQADDLSDWLREKERSASAEDYG
QDLEDCQQIIEQFESTVRELAAAGERVAAVQRAQEDLLRSGHPYGASITAKGADVQRLWT
HVNEVANERKQALNGARQVHRFDQEADQILNWLQDKEATGVAMEQEDLSRADLASVKAQL
QRHDEFMHGMKAVEKQVAELCHEAERLWNSFPDTRHHLEVRRLDMEEQLKDILEAAKKHL
EKLRHMQSLQSYFQEYREMMQWMKNMQSTMTSEQLPRDVASCESLVRRHDEYNLEMQGRK
PFVDDFARQGRRMIQSSHVLSQEIQEKVDILEKSWAMLCEIWKDRAELYEENMDVQKWKQ
NAEQLDSWLEERAGLLGDDWRMVDSVEMAETHLRDFDDFLVTLEAQSEKCDMVKRLTLVE
QNFSRLRSKEIDRARIAEDDQKRRDTIKIVEKGNILANRRQERERRKTQEISLLRPSPSG
EEFSTHTMPRKERKDRAKTTADLAPGAIQIGDILASSSTVAPLQSGVEMTKTPSFNTRRT
QSIRKGSRWEDMGAIDMKGFFDRKQCQQSGGKRATIRSWKNYYGILCGQLLCFFKDEQQF
LENVAAAPPVYIYGAQCEQYPEYAKRKNSFRLLLQDGSEFIFSCPDERQMLEWVAKIKFH
AHLTPSNQLKSYAYNDDLFQSPDQPPMVAPRRNIGGHDVANRMSHASSVFTTSDDLEQHE
LDYSRDHAELRHTIQVHPGSSGYTETLMYKEHTSSNYQPMERSVSPRNQQNGEFITWVES
NQQNQPMNTPDGRSTSASVVSTPSNYDDSDSIKSSSKRKGFGSLFKRGSKHSK
Download sequence
Identical sequences G5EBH3
R31.1d NP_001256383.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]