SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T01E8.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  T01E8.3
Domain Number 1 Region: 352-525,921-1094
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 2.36e-114
Family Mammalian PLC 0.0000195
Further Details:      
 
Domain Number 2 Region: 1112-1237
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 7.44e-29
Family PLC-like (P variant) 0.0022
Further Details:      
 
Domain Number 3 Region: 600-710
Classification Level Classification E-value
Superfamily SH2 domain 1.02e-24
Family SH2 domain 0.00041
Further Details:      
 
Domain Number 4 Region: 710-806,859-883
Classification Level Classification E-value
Superfamily SH2 domain 1.71e-22
Family SH2 domain 0.0004
Further Details:      
 
Domain Number 5 Region: 815-888
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000326
Family SH3-domain 0.0014
Further Details:      
 
Domain Number 6 Region: 533-573,904-955
Classification Level Classification E-value
Superfamily PH domain-like 0.0000032
Family Pleckstrin-homology domain (PH domain) 0.029
Further Details:      
 
Weak hits

Sequence:  T01E8.3
Domain Number - Region: 238-354
Classification Level Classification E-value
Superfamily EF-hand 0.000265
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 
Domain Number - Region: 100-181
Classification Level Classification E-value
Superfamily PH domain-like 0.0269
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: T01E8.3   Gene: WBGene00004038   Transcript: T01E8.3
Sequence length 1350
Comment pep:known chromosome:WBcel235:II:10222878:10229436:1 gene:WBGene00004038 transcript:T01E8.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQHGSLGPSSSSRKTTVTSTAGSVHLHHRSSNGFSTASRAQLNRHNEMDFGKMFAAMEKG
HKVCKIAVLKKWDPAYKQLTLDRYSRQIFLTKLELSAVRNKPTILDIRQIREVQTLNYKL
NTIKVDDKWKKDREIVNFDSKAILIISYGMGFALSYWILLFESEDACKLWSQGLHNLMMD
TRDRDSSPHPLRIERFLHKHFLSLMSPANDAVARKHMKPFVQTSLQFKVQSDQLQQVTED
QMNSDQFSFASRQLIHVPELFSSRFADLAEKHERKGLVVTFQNFLRFLDGKQFDELASNR
TRALEFLNRYFQEDQAYFGDRNEPSMTVFEFCDFLFSRENSLWDPTNEKVTHDMSRPLSH
YWIASSHNTYLTGDQLRSESSLDCYAQALLMGCRCIELDCWDGQKKPGSAEFIDIVIYHG
YTMTSKILLRDVLHVIRHYAFVTSEYPVILSIEDNCSVPAQRLLAQELKDILGDYLLTQP
ANREEKQLPSPAALKKKIIVKHKKLPIESEDLAAVVKTDEFQDTEIISRECVKKGILMVK
NNNSHEWTSHVFILFPDRLCYLIQTADPENPNDDTVSVSGDEEREEETPSGFGVKPEEMH
VTEEWFHGRCERDEAKKRILEHKEKGNGLFMIRDSNLFIGDFSLSILHDGKVHHVRIRSK
IIDKEKKYYFMDNKVCDTLYELVSYYTRHYLTTAHFKMVLTIPCPQPQPHLNQPWFSATA
DKEKAEELLSLVPEDGAFLIRTSSTDSSVYVLSLKVDGEFWHYRLKRDGRIFVVNQKVFE
NLNQIVEFYANREFVRGISLRFPVNEKDISHLTAELAEARTPGCYMDLKDLDKEVQARAL
RPYRGTADDELSFPANVIITVLRKEEGLWRGRYGSLTGWFPSAHVQEILPEKVSTSETSN
YNTIELAGTLIERIHDADRPNVIRISQSNQHWMNKQYYLLAASSSEEADGWQNNLFELTR
SVNTKMSILRTKEKEKRIAAELSNLVVYCQAVPFDPAHIYNDAFYEMCSFVEGKLDKLVE
KGLLPFNSRKLSRVYPNGSRITSNNYSPVPMWNAGCHMVALNYQTGDKPMQLNQGKFLAN
GRCGYLLKPDYMLTDDFDPTNTEKFATAYPIRLNVQVIGGRHLSRKDKNKGICSPFVEIE
IIGMPCDTKVFQTKTIASNGLNPIWNQTFTFEIQCPEVALIRFHVEDGDFVGPKTDPFIG
QAVFPVDSIRCGFRSVPLKNQYSEELELSSLLVDVQMCSREGTQLIRSSSHFLQASRLAP
VFAHRKITNGDSIPREMAPRLRTSATDRSLDSPTNSESRATLLSGQRGSQDSMDSAAETS
SIASGTISSRDGKKKQNWLKKFSFGKSSKS
Download sequence
Identical sequences Q22070
T01E8.3 T01E8.3 6239.T01E8.3 T01E8.3 NP_496205.2.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]