SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for T07A5.6a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  T07A5.6a
Domain Number - Region: 34-92
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0016
Family Spectrin repeat 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: T07A5.6a   Gene: WBGene00006802   Transcript: T07A5.6a
Sequence length 108
Comment pep:known chromosome:WBcel235:III:10318984:10319755:1 gene:WBGene00006802 transcript:T07A5.6a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKTEQDDIPLADDDDTVTIISGGKTPRAAQPLPKEEPPEDPEEKARMITQVLELQNTL
DDLSQRVESVKEESLKLRSENQVLGQYIQNLMSSSSVFQSSQPSRPKQ
Download sequence
Identical sequences Q9U377
NP_001022752.1.50509 T07A5.6a T07C4.10B T07A5.6a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]