SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W04D2.1c from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W04D2.1c
Domain Number 1 Region: 3-184
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.06e-71
Family Calponin-homology domain, CH-domain 0.0000161
Further Details:      
 
Domain Number 2 Region: 226-349
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-32
Family Spectrin repeat 0.00000492
Further Details:      
 
Domain Number 3 Region: 464-585
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-24
Family Spectrin repeat 0.0000247
Further Details:      
 
Domain Number 4 Region: 350-459
Classification Level Classification E-value
Superfamily Spectrin repeat 3.8e-23
Family Spectrin repeat 0.000011
Further Details:      
 
Domain Number 5 Region: 588-700
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-17
Family Spectrin repeat 0.0000355
Further Details:      
 
Domain Number 6 Region: 692-812
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000376
Family EF-hand modules in multidomain proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: W04D2.1c   Gene: WBGene00000228   Transcript: W04D2.1c
Sequence length 849
Comment pep:known chromosome:WBcel235:V:12479738:12484452:1 gene:WBGene00000228 transcript:W04D2.1c gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEEIVDGNVKMTLG
LIWTIILRFAIQDINVEELSARDGLLLWCQRKTAPYNNVNVQNFHNSWKDGLAFCALIHR
HRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDIPKMLDAEDVSRHPDEKSTMTYVSCFYH
AFRNMRDPPPPVIRQPPPQRVVVAPPPERDWRKDAETAANRICRVLKVNQENEKMMEDYE
NLASDLLAWINRWMPWLANRSTDDTLQQAQQKLEDYRNYRRREKPPRIEDKGRLETLFNT
LQTRLRLSNRPAFLPRDGHLIKDINAAWAGLEDSEKGFEEWLLSEIMRLERLEHLAEKFR
RKCALHEEWAHGKEDALRSNDWRSCGLYKIKALRKRHEAFESDLGAHQDRVEQIAAIARE
LNNLRYPDIGPINARCQAICSQWDRLGQLSSKRRETLEDAERIAERLDSLYLDFAKRAAP
FNNWLDGAREDLADLVIVHEMREIEELVNAHDQFKSTLGDADREFSSINQIEHEVEHLVT
SHGLDRELLRNPYTDLSASDIRRKWGEVQNSVPRRDSQLQAELKRQQNNERLRTIFAEKA
NQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRSIQRNVLGYKPNLDELERVHQEMQENF
VFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEEQIAEFRASFSHFD
KERAGLDPEQLRSCLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKEN
SDQDTVEQMIDSFRILASGKTFITADELERELPRDQAAYCMARMAPSREPGAPPRSFDYV
TFSRSLYSQ
Download sequence
Identical sequences H2L2C9
NP_001256423.1.50509 W04D2.1c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]