SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y106G6D.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Y106G6D.2
Domain Number - Region: 29-146
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0282
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y106G6D.2   Gene: WBGene00013699   Transcript: Y106G6D.2
Sequence length 248
Comment pep:known chromosome:WBcel235:I:10110855:10111851:1 gene:WBGene00013699 transcript:Y106G6D.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVKRIDNSDSIFFLESPERDIRIEKYFSDKCSKLKKRNEDMNEEIKWRKTRISDYGEHL
NMSLDELKDKFKAVTRKRDTIRFTEHLKKKQEKLYKDLESIKEDSKNNTIHGNVLRFRRE
YENEDSKRKLDEMKNTLDQLKSENKAWKILSEDVQCESDLWNLVTEKRKSSWLTEKKINE
YMSNMQKNLSSAVNEFNTLRGQIRNELNPEDNDEEEAKIRKQNMMKKQMERKLEKLKIDN
ADLLKSNC
Download sequence
Identical sequences Q9XX62
Y106G6D.2 6239.Y106G6D.2 Y106G6D.2 Y106G6D.2 Y106G6D.2 NP_492666.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]