SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y106G6G.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Y106G6G.1
Domain Number - Region: 90-173
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0576
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y106G6G.1   Gene: WBGene00013710   Transcript: Y106G6G.1
Sequence length 368
Comment pep:known chromosome:WBcel235:I:10329027:10330370:1 gene:WBGene00013710 transcript:Y106G6G.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKVSEHGQNKSELSSLSSISTTTSVWNKLDRSIDHLIYHCNGYENSTNYLNQYRKWLI
ASRNDDVDVLEKLVAQTGLLGQKFADVGPEMDEKIEESLTWLFRKIGWRPSKEQQNIGYA
GYEDMLLRYRGLNKELDMLKSIIKQTSNVFAQIVQEHRMMGQMNEKLDELRFRAALLKVA
TTVAGRTENENDPLSSVFYLPVLLAGIIFHPDTSQSYAAGLLRLCKRLLVVSEVVQYEKN
PKKNDPIVTMSNILIHPAQSSVQSFYVPEQICADGNGEVCAPEEKLVLPIARDSVHLMTS
NVNGEVTAPEEKIDPVARDSSHALPENGEVTGNSEISMPIAKDSATTLISKELPQPMSKP
EDLEKSSK
Download sequence
Identical sequences G5ED74
NP_492707.1.50509 Y106G6G.1 Y106G6G.1 Y106G6G.1 6239.Y106G6G.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]