SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y116F11A.6 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y116F11A.6
Domain Number 1 Region: 29-98
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000589
Family Caspase recruitment domain, CARD 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: Y116F11A.6   Gene: WBGene00013819   Transcript: Y116F11A.6
Sequence length 103
Comment pep:known chromosome:WBcel235:V:19727481:19727922:1 gene:WBGene00013819 transcript:Y116F11A.6 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTVSCSPSLADIRALQADNLDRLRDSLQQINIRDVVPLLVARNVLRSYEMGALYEKGSG
EQVDALIDLLKTKNHWVGPLTDALIRNGKAPIATILLELQTGK
Download sequence
Identical sequences Q9U3T5
183 Y116F11A.A Y116F11A.6 6239.Y116F11A.6 Y116F11A.6 Y116F11A.6 NP_507818.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]