SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y119D3B.12b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Y119D3B.12b
Domain Number - Region: 88-148
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0204
Family Spectrin repeat 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: Y119D3B.12b   Gene: WBGene00022489   Transcript: Y119D3B.12b
Sequence length 224
Comment pep:known chromosome:WBcel235:III:1202548:1207258:1 gene:WBGene00022489 transcript:Y119D3B.12b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDYMAQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKY
TTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEE
TFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEA
EKLKSEKERAINMEENVTAAPLDRRRRRRAGTQNSPNFCTIFSC
Download sequence
Identical sequences Q8IAB4
NP_871668.1.50509 Y119D3B.12b Y119D3B.12b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]