SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Y73B6BL.7 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Y73B6BL.7
Domain Number 1 Region: 580-824
Classification Level Classification E-value
Superfamily Caspase-like 7.78e-63
Family Caspase catalytic domain 0.0000359
Further Details:      
 
Domain Number 2 Region: 150-271
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000063
Family Spectrin repeat 0.012
Further Details:      
 
Weak hits

Sequence:  Y73B6BL.7
Domain Number - Region: 90-163
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00785
Family HBL-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: Y73B6BL.7   Gene: WBGene00000820   Transcript: Y73B6BL.7
Sequence length 826
Comment pep:known chromosome:WBcel235:IV:6307739:6315719:1 gene:WBGene00000820 transcript:Y73B6BL.7 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKIGWLLITICSGIITKCINAHSSPYQNANESAIDDAYFLVLIIPAVSVAIVLVVVIFLC
CPRQQIRSDNVIKLEEGVNDVIEENVTHVVSLREAKVSGMMTDLTRFRQEIFTKHLTFNS
NPESIDAATKNVQNVKQSLDTWRDRIKERLDEIDRLCTEEGDSLTPEQYSALREMRRQLA
DEYDTVLRTVEGIHTRLNILSALLIEFSSVTSSMQSWMTDRARLAGDIRHKSGDPMRVDE
ARFEAKSLMDEVVREESRLKTIGASVLKIEQEISAMRDDVRASRSTDDVGISMDEVYEKR
RRVEVDYMQLLRQCQDLISLQIRLHAMNDEHAEQARRAEGWLQMLKNDVAGVAKDPRFKK
DEDLIERDEELNRMAAGGSGGPTSRQLAMREKIEQREREEEEWRRKAKEKFEEEAAKNRA
RERKWAEEHGFNRPIRTRSQKYAEQDRIRYARKKAALEQSNEQSNESTDDAVESDSDDVP
APQSPPTPSPADPGPTTSSSSLTQDPASNATGFSDVPAPQAPPTPSPADPGPTTSSSSLT
QDPASNATGFSGSSPPNSFEETRMMCEDASDGKKIDETRKYRNNRSSKCRAIIINNVVFC
GMEKRIGSDKDKKKLSKLFERLGYQSTSYDNLKSSEILETVRQFTQSNHGDSLIITIMSH
GDQGLLYGVDGVPVQMLDIIDLMCTASLAKKPKWLMCVCCRGDRIDRAVRCDGFIDNFFD
RFPKFFQFMKSKFPSHQTSSSQADLLVSFSTSPGFLSFRDETKGTWYIQELYRVIIENAK
DTHLADLLMETNRRVVEKYEADKVVIVCKQAPEFWSRFTKQLFFDV
Download sequence
Identical sequences Y73B6BL.7 Y73B6BL.7 NP_001023575.1.50509 AAC98295 AAC98296 Y73B6BL.7 6239.Y73B6BL.7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]