SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK1151.1d from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1151.1d
Domain Number 1 Region: 13-255
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.61e-64
Family Calponin-homology domain, CH-domain 0.0000287
Further Details:      
 
Domain Number 2 Region: 1783-1928,1970-2027,2071-2092
Classification Level Classification E-value
Superfamily Plakin repeat 1.44e-33
Family Plakin repeat 0.0065
Further Details:      
 
Domain Number 3 Region: 1452-1660
Classification Level Classification E-value
Superfamily Plakin repeat 6.28e-28
Family Plakin repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 2833-3001
Classification Level Classification E-value
Superfamily Plakin repeat 1.13e-27
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 2435-2599
Classification Level Classification E-value
Superfamily Plakin repeat 1.4e-24
Family Plakin repeat 0.0036
Further Details:      
 
Domain Number 6 Region: 2185-2248,2305-2387
Classification Level Classification E-value
Superfamily Plakin repeat 2.44e-22
Family Plakin repeat 0.0061
Further Details:      
 
Domain Number 7 Region: 2680-2861
Classification Level Classification E-value
Superfamily Plakin repeat 2.88e-18
Family Plakin repeat 0.0097
Further Details:      
 
Domain Number 8 Region: 2977-3127
Classification Level Classification E-value
Superfamily Plakin repeat 6.02e-18
Family Plakin repeat 0.0024
Further Details:      
 
Domain Number 9 Region: 1143-1262,1295-1321
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 10 Region: 656-785,846-870
Classification Level Classification E-value
Superfamily Spectrin repeat 8.23e-17
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 11 Region: 1688-1802
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000458
Family Plakin repeat 0.02
Further Details:      
 
Domain Number 12 Region: 3219-3315
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000288
Family Plakin repeat 0.0046
Further Details:      
 
Domain Number 13 Region: 262-370
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000326
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 14 Region: 956-1049
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000366
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 15 Region: 507-600
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000017
Family Spectrin repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  ZK1151.1d
Domain Number - Region: 779-836
Classification Level Classification E-value
Superfamily SH3-domain 0.00138
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK1151.1d   Gene: WBGene00006876   Transcript: ZK1151.1d
Sequence length 3405
Comment pep:known chromosome:WBcel235:I:11764303:11792066:-1 gene:WBGene00006876 transcript:ZK1151.1d gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERYRSHHAVDPSDAQEKEVLDHYELNREKYNDERDNVQKKTFTKWVNKHLSKTDHKI
DDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNVSVIRQRLL
LESSQHEQMSAKHTTTNSQVSLHGSDATSARDALLQWARRVTAGYPRVNVNNFSSSWRDG
LAFNAILHRYRSSAIDWNKISSDSVSNTERLNNAFAAADREFGVERLLDAEDVDTNNPDE
KSIITYVSSLYNALPHEPEMSRLQKVQEEYIEEAYEWREWVVRAIQLVDDRHLQGTASEL
IYELQRFREDDLPPREEQKRRLTLVYEHLEKVMRSTELFAIPHELSAPELQRVWNELQNS
IDRRFDVLERHRIQEGNSNDLLSRLARGIGITNEKLDLILKRIEDVEARVDTSPPAAVER
TVSEIVDDLNALESPIARFFEDVEELKSMQHPEANDFYKQVYGLHQRRTTYLDRLTNQIL
VRLGVRTDSLHKENQQRLENMRKTSFSRVEECIEWVRVRMEKLTTMEFLEDLETLEHVFE
QHKFDNRDIQDFRQNVDECIARQAEVSAEDTYEYCELLRVLESEYQQLRDLSAGRMLDLD
SLIAFVRAAQLELIWVSERESIEVTRNWSDIKQLDLPMLTNYYKQLLHEMELREKQYNDV
HNQGAALLNQGHPAIRVIEVYLRQMQSQWDWLLALSKCLEEHLRDALNLKSFMEEASDAE
AWIQEQSVRLENNYNRTDFSLEEGERFLRELDEIKEILNKYHQVLMALTERCASISPLWQ
RGERIPHPIKVTALCDYSDENVTIKAGDDVYLLDNSDLIKWTIRDISGAEGQVPSVVFRI
PPTDARLTALLNRLLQQFEKLKKLWDKKHRMVRFNMVLNTMRTIQGWDLDTFNSIDPDQR
DAIMKALNDDANKLLSELDPNDPLALRLREELRRTNEHFWNLLNASQKPPEPDWASQYDQ
KMAELLKKLEEAWRELNDAVGKPISRSPEDLERVIHAHKRFEDALQALDSDVANVKELFR
QLPNPTPTQRVNHDRLNGLWDDLWDLSRMYVERIKVLESVLNGMVEVADIVRQHEITLNS
FDDLPAALDKLRGHHSQLLEINMVLKVSKLGAQNEHFSQQQTVIDQLNRNVALLRQHVSR
TRINEGHHPDVDAIEDEVQKLNVRWENVNSQIASRLLAVESALQIQMVYRSEYETEMSWL
DTVEETINRLRKPEELRPEQYQQQLDMLIAEYTNLQEHTQAIEHVNKEGGRFIHEAKIFD
AKLGQYSDGIVGIHGPGIKSEFRRTKPQPKNGSQIVTEELELLNRRFAQLSSLILERRNT
MQVLIQNWKRQKQEEEDRRRAEEEEKRRAFEAARLKALEDAERLRREREDAEARRRAKDD
ADRARRMAEDAERARREAEEAERRRREEEERRRREAEDRKRRQDEEDRRRREEEERRRRE
EEEKRRKKPDFDLKIQKPTMNIEPVVTSAGDEWEIVDPIGDRAKISEVEDEMQTFAEETI
TNTQFYEMEGNLNKKTGEVLTFIEAIRQGNLTAAGQFFDIPSASVMSLEEAAKYGLVEQD
LPTVLNTTWGIHHPETRQPITLSEAIRIGLYDSNIRQFRDIHTGEILSQSDLMSKGIANW
ETVLKLIKEKIMKLPPTSLANALEKRMVDPQTGVFKGRTTDMELQLWAAIYHGYLSIENP
EHVTTIGTSLTDAIENGFINANNAEFNDRNSNDSFKLRDAVSKRTGLINNDVVEIVQMTD
DEKKRVPLGAALVRNVIGVKDGKYTNLASRQSMSLKEAHQDGLIGKALTLEEAAQNKLVD
SSGYFVDRGILGQRYTLLEAIVAGLIDAEVRHIVDPNENDVISISEAMERGLLLPNGKIV
LEKDEKEFTIPEAVHEGLLTKRVRHSIFNIRGIRNTETSQNLSFNEAVEAGVIIPNAERV
VDLQTQESFLITDDRAKNLIEVALHELLTTPVGIKNDRGAYELNLVRAVSSGIIDPVKGV
FFNKNTKHELSTKEAYEQGFITLRGALKVFGLLNVPPALVTPAKKLDRTRRIGRPGQEGG
ADGNHVTVTLQDAMRQGLVGNQRYVHGKVDLSLEEALNRGLLDPNSQWIMPDQSKGDGPT
IEEKTTETMTETGQQLAPKYFPDKNIEESVTTVKRVRTTETTALGGPGGVSVYRSIAGGK
GALEVPSRGYHIYEAERKGLIDLTNGKISAPNVDRVLSFAEGIELGIIDATTIQVSTGGR
SVSVKEALEKKIMESDGSVNGRNIEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPI
ISFRQVGQPVVEESTQSWEFDTQQGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTG
REMPLEEAEKWGIIDSKNRYYFDKSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVK
VQTRTAVAKKEALSSGLPLSDYSLGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLF
DPYDTTIVDKKAGKEISLLEAIREEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFG
DTLDSSLFSGRLDLGSGSYTRPSGGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEA
VDRRIVDADRGLIHGGGDSTSFSQGLTSGHLVSSGSSRPTSGNQSRLVEQRLQLTPFAPN
GGAGRSRDGRHELVDLGGGQQVQVKVVRGEGGVEKGEYTDPKSGMKFTIQMHGDPVVTET
KTSVKSTSQVHSVELEPHAEFVGIDRVRDKRNNHVYSLEEARRLGLAKVDKKGKQMTRSY
QAFRSNIDNAVNNGVVDSHNQKISLENAIHARIIDIRNLSYHHPTHGSVDLKTAASQGLV
DVTLSEVLPKGIIHPGTGERIDIKRGIELRIIDAATGKVRDPRDNKTITWIDILKPVYQA
IASEGVFDPTKGHHVPVTTALNDGLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYET
ITKPFFTDYRSNRKLNLVEAVRERLIDPKNRTIQLSRQSIVPIAKAVQDGRIPMEIGEKL
RKVDKLNFAEALGKGLIDSKQNVFTDPDTGRQMSIAQAIQEGFIDTGSVQGIEGNDESNL
FNVLQSSDFDETSGRIYDKKSSLHLTFNDAVRRGVIDGDSLLHLQATGDLLTLRDALHQN
KIDSNGKFVEGANRLKISDAVKSGRLTVIASPSEAVQAVTEGVKRRDAEGYKFRISEYDD
SQAQRQSVPKFRETVTVSKLTPQYNEPGLSVRMRQSTTSIGDRASKFLEDPSQLAEIQQD
FLSSLEAAQFDTDEKVIEHPHTRQRVSVREAAETGLLDVQTGEIVNPDNGRRFSIPRAVH
MKLVGGDAAKRIMEQLNMPVEEVAYATQTITSSTHRAPSPVFATASVSQPSGGATTTREF
TRTINWHGQPSELRNSQTDPLAAYTTVSSNVTESTEDAPAWARKQ
Download sequence
Identical sequences G5EFW2
NP_001021856.1.50509 ZK1151.1d ZK1151.1d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]