SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK1151.1f from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1151.1f
Domain Number 1 Region: 13-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.96e-81
Family Calponin-homology domain, CH-domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 1369-1577
Classification Level Classification E-value
Superfamily Plakin repeat 6.15e-28
Family Plakin repeat 0.0034
Further Details:      
 
Domain Number 3 Region: 2750-2918
Classification Level Classification E-value
Superfamily Plakin repeat 1.05e-27
Family Plakin repeat 0.0033
Further Details:      
 
Domain Number 4 Region: 2352-2516
Classification Level Classification E-value
Superfamily Plakin repeat 1.4e-24
Family Plakin repeat 0.0036
Further Details:      
 
Domain Number 5 Region: 2102-2165,2222-2304
Classification Level Classification E-value
Superfamily Plakin repeat 2.35e-22
Family Plakin repeat 0.0061
Further Details:      
 
Domain Number 6 Region: 1701-1843
Classification Level Classification E-value
Superfamily Plakin repeat 7.72e-22
Family Plakin repeat 0.0082
Further Details:      
 
Domain Number 7 Region: 2597-2778
Classification Level Classification E-value
Superfamily Plakin repeat 2.88e-18
Family Plakin repeat 0.0097
Further Details:      
 
Domain Number 8 Region: 1807-1944,1988-2009
Classification Level Classification E-value
Superfamily Plakin repeat 5.82e-18
Family Plakin repeat 0.004
Further Details:      
 
Domain Number 9 Region: 2894-3044
Classification Level Classification E-value
Superfamily Plakin repeat 5.89e-18
Family Plakin repeat 0.0024
Further Details:      
 
Domain Number 10 Region: 1174-1293,1326-1352
Classification Level Classification E-value
Superfamily Spectrin repeat 1.24e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 11 Region: 687-816,877-901
Classification Level Classification E-value
Superfamily Spectrin repeat 8.47e-17
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 12 Region: 1605-1718
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000000000602
Family Plakin repeat 0.02
Further Details:      
 
Domain Number 13 Region: 3136-3232
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000000000275
Family Plakin repeat 0.0046
Further Details:      
 
Domain Number 14 Region: 293-401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000317
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 15 Region: 987-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000353
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 16 Region: 538-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000144
Family Spectrin repeat 0.0067
Further Details:      
 
Weak hits

Sequence:  ZK1151.1f
Domain Number - Region: 810-867
Classification Level Classification E-value
Superfamily SH3-domain 0.00131
Family SH3-domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK1151.1f   Gene: WBGene00006876   Transcript: ZK1151.1f
Sequence length 3322
Comment pep:known chromosome:WBcel235:I:11764303:11792118:-1 gene:WBGene00006876 transcript:ZK1151.1f gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERYRSHHAVDPSDAQEKEVLDHYELNREKYNDERDNVQKKTFTKWVNKHLSKTDHKI
DDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPE
DIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATS
ARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTE
RLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEE
YIEEAYEWREWVVRAIQLVDDRHLQGTASELIYELQRFREDDLPPREEQKRRLTLVYEHL
EKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGI
GITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSM
QHPEANDFYKQVYGLHQRRTTYLDRLTNQILVRLGVRTDSLHKENQQRLENMRKTSFSRV
EECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDECIARQAEVSAE
DTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWS
DIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQW
DWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNRTDFSLEEGERFLR
ELDEIKEILNKYHQVLMALTERCASISPLWQRGERIPHPIKVTALCDYSDENVTIKAGDD
VYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKH
RMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSELDPNDPLALRLR
EELRRTNEHFWNLLNASQKPPEPDWASQYDQKMAELLKKLEEAWRELNDAVGKPISRSPE
DLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRM
YVERIKVLESVLNGMVEVADIVRQHEITLNSFDDLPAALDKLRGHHSQLLEINMVLKVSK
LGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEGHHPDVDAIEDEVQKLNVRWENVN
SQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETINRLRKPEELRPEQYQQQLDMLI
AEYTNLQEHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTKPQP
KNGSQIVTEELELLNRRFAQLSSLILERRNTMQVLIQNWKRQKQKPDFDLKIQKPTMNIE
PVVTSAGDEWEIVDPIGDRAKISEVEDEMQTFAEETITNTQFYEMEGNLNKKTGEVLTFI
EAIRQGNLTAAGQFFDIPSASVMSLEEAAKYGLVEQDLPTVLNTTWGIHHPETRQPITLS
EAIRIGLYDSNIRQFRDIHTGEILSQSDLMSKGIANWETVLKLIKEKIMKLPPTSLANAL
EKRMVDPQTGVFKGRTTDMELQLWAAIYHGYLSIENPEHVTTIGTSLTDAIENGFINANN
AEFNDRNSNDSFKLRDAVSKRTGLINNDVVEIVQMTDDEKKRVPLGAALVRNVIGVKDGK
YTNLASRQSMSLKEAHQDGLIGKALTLEEAAQNKLVDSSGYFVDRGILGQRYTLLEAIVA
GLIDAEVRHIVDPNENDVISISEAMERGLLLPNGKIVLEKDEKEFTIPEAVHEGLLTKRV
RHSIFNIRGIRNTETSQNLSFNEAVEAGVIIPNAERVVDLQTQESFLITDDRAKNLIEVA
LHELLTTPVGIKNDRGAYELNLVRAVSSGIIDPVKGVFFNKNTKHELSTKEAYEQGFITL
RGALKVFGLLNVPPALVTPAKKLDRTRRIGRPGQEGGADGNHVTVTLQDAMRQGLVGNQR
YVHGKVDLSLEEALNRGLLDPNSQWIMPDQSKGDGPTIEEKTTETMTETGQQLAPKYFPD
KNIEESVTTVKRVRTTETTALGGPGGVSVYRSIAGGKGALEVPSRGYHIYEAERKGLIDL
TNGKISAPNVDRVLSFAEGIELGIIDATTIQVSTGGRSVSVKEALEKKIMESDGSVNGRN
IEQAVEAKTIVIDAEPLVPYNNQSKNIIQIPSGNGPIISFRQVGQPVVEESTQSWEFDTQ
QGVFVDNLTGEKLSLERALATGKVAPEDISVRDGLTGREMPLEEAEKWGIIDSKNRYYFD
KSQNKRMSYTEAAQQHLMYLTGGVPENASDAVHTTVKVQTRTAVAKKEALSSGLPLSDYS
LGKALSLGWYDQSAGTFTHPETQKQLTLKEAIMKGLFDPYDTTIVDKKAGKEISLLEAIR
EEIVDDNAGTVKDTQTGRVHNFLEAGNLGLVKGKNFGDTLDSSLFSGRLDLGSGSYTRPS
GGSSMPIHEAINRNYVDRSSVSVRDPSSGQQYSYQEAVDRRIVDADRGLIHGGGDSTSFS
QGLTSGHLVSSGSSRPTSGNQSRLVEQRLQLTPFAPNGGAGRSRDGRHELVDLGGGQQVQ
VKVVRGEGGVEKGEYTDPKSGMKFTIQMHGDPVVTETKTSVKSTSQVHSVELEPHAEFVG
IDRVRDKRNNHVYSLEEARRLGLAKVDKKGKQMTRSYQAFRSNIDNAVNNGVVDSHNQKI
SLENAIHARIIDIRNLSYHHPTHGSVDLKTAASQGLVDVTLSEVLPKGIIHPGTGERIDI
KRGIELRIIDAATGKVRDPRDNKTITWIDILKPVYQAIASEGVFDPTKGHHVPVTTALND
GLINASTGNYRNSITGEDVPLSDTVDRGLIDRSTYETITKPFFTDYRSNRKLNLVEAVRE
RLIDPKNRTIQLSRQSIVPIAKAVQDGRIPMEIGEKLRKVDKLNFAEALGKGLIDSKQNV
FTDPDTGRQMSIAQAIQEGFIDTGSVQGIEGNDESNLFNVLQSSDFDETSGRIYDKKSSL
HLTFNDAVRRGVIDGDSLLHLQATGDLLTLRDALHQNKIDSNGKFVEGANRLKISDAVKS
GRLTVIASPSEAVQAVTEGVKRRDAEGYKFRISEYDDSQAQRQSVPKFRETVTVSKLTPQ
YNEPGLSVRMRQSTTSIGDRASKFLEDPSQLAEIQQDFLSSLEAAQFDTDEKVIEHPHTR
QRVSVREAAETGLLDVQTGEIVNPDNGRRFSIPRAVHMKLVGGDAAKRIMEQLNMPVEEV
AYATQTITSSTHRAPSPVFATASVSQPSGGATTTREFTRTINWHGQPSELRNSQTDPLAA
YTTVSSNVTESTEDAPAWARKQ
Download sequence
Identical sequences G5EFK7
ZK1151.1f NP_001021858.1.50509 ZK1151.1f

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]