SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ZK1151.1g from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ZK1151.1g
Domain Number 1 Region: 13-286
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.75e-81
Family Calponin-homology domain, CH-domain 0.00000955
Further Details:      
 
Domain Number 2 Region: 4193-4264
Classification Level Classification E-value
Superfamily GAS2 domain-like 5.36e-22
Family GAS2 domain 0.00057
Further Details:      
 
Domain Number 3 Region: 3160-3321
Classification Level Classification E-value
Superfamily Spectrin repeat 7.85e-21
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 3274-3424
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-20
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 5 Region: 2283-2443
Classification Level Classification E-value
Superfamily Spectrin repeat 3.28e-19
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 6 Region: 1174-1293,1326-1352
Classification Level Classification E-value
Superfamily Spectrin repeat 2.16e-17
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 7 Region: 3500-3648
Classification Level Classification E-value
Superfamily Spectrin repeat 7.01e-17
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 8 Region: 687-816,877-900
Classification Level Classification E-value
Superfamily Spectrin repeat 1.34e-16
Family Spectrin repeat 0.0079
Further Details:      
 
Domain Number 9 Region: 2393-2542
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000137
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 3051-3209
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000365
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 11 Region: 2503-2661
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000157
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 12 Region: 2836-2990
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000475
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 13 Region: 3821-3964
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000746
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 14 Region: 3727-3867
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000471
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 15 Region: 293-401
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000436
Family Spectrin repeat 0.0029
Further Details:      
 
Domain Number 16 Region: 600-729
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000684
Family Spectrin repeat 0.0042
Further Details:      
 
Domain Number 17 Region: 2717-2838
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000834
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 18 Region: 987-1080
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000497
Family Spectrin repeat 0.0085
Further Details:      
 
Domain Number 19 Region: 3916-4056
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000036
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 20 Region: 3407-3513
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000127
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 21 Region: 538-631
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000209
Family Spectrin repeat 0.0067
Further Details:      
 
Domain Number 22 Region: 3658-3761
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000763
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 23 Region: 1973-2119
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000751
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number 24 Region: 1860-2015
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000774
Family Spectrin repeat 0.018
Further Details:      
 
Weak hits

Sequence:  ZK1151.1g
Domain Number - Region: 1431-1549
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 810-867
Classification Level Classification E-value
Superfamily SH3-domain 0.00179
Family SH3-domain 0.0017
Further Details:      
 
Domain Number - Region: 4093-4177
Classification Level Classification E-value
Superfamily EF-hand 0.00264
Family Polcalcin 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ZK1151.1g   Gene: WBGene00006876   Transcript: ZK1151.1g
Sequence length 4410
Comment pep:known chromosome:WBcel235:I:11747428:11792118:-1 gene:WBGene00006876 transcript:ZK1151.1g gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGERYRSHHAVDPSDAQEKEVLDHYELNREKYNDERDNVQKKTFTKWVNKHLSKTDHKI
DDLFVDLRDGYALIALLEALTGERIQKENGYTRFHRIQNVQYCLDFLKKKNIKLVNIRPE
DIVEGNGKLTLGLIWTIILNFQVSVIRQRLLLESSQHEQMSAKHTTTNSQVSLHGSDATS
ARDALLQWARRVTAGYPRVNVNNFSSSWRDGLAFNAILHRYRSSAIDWNKISSDSVSNTE
RLNNAFAAADREFGVERLLDAEDVDTNNPDEKSIITYVSSLYNALPHEPEMSRLQKVQEE
YIEEAYEWREWVVRAIQLVDDRHLQGTASELIYELQRFREDDLPPREEQKRRLTLVYEHL
EKVMRSTELFAIPHELSAPELQRVWNELQNSIDRRFDVLERHRIQEGNSNDLLSRLARGI
GITNEKLDLILKRIEDVEARVDTSPPAAVERTVSEIVDDLNALESPIARFFEDVEELKSM
QHPEANDFYKQVYGLHQRRTTYLDRLTNQILVRLGVRTDSLHKENQQRLENMRKTSFSRV
EECIEWVRVRMEKLTTMEFLEDLETLEHVFEQHKFDNRDIQDFRQNVDECIARQAEVSAE
DTYEYCELLRVLESEYQQLRDLSAGRMLDLDSLIAFVRAAQLELIWVSERESIEVTRNWS
DIKQLDLPMLTNYYKQLLHEMELREKQYNDVHNQGAALLNQGHPAIRVIEVYLRQMQSQW
DWLLALSKCLEEHLRDALNLKSFMEEASDAEAWIQEQSVRLENNYNRTDFSLEEGERFLR
ELDEIKEILNKYHQVLMALTERCASISPLWQRGERIPHPIKVTALCDYSDENVTIKAGDD
VYLLDNSDLIKWTIRDISGAEGQVPSVVFRIPPTDARLTALLNRLLQQFEKLKKLWDKKH
RMVRFNMVLNTMRTIQGWDLDTFNSIDPDQRDAIMKALNDDANKLLSELDPNDPLALRLR
EELRRTNEHFWNLLNASQKPPEPDWASQYDQKMAELLKKLEEAWRELNDAVGKPISRSPE
DLERVIHAHKRFEDALQALDSDVANVKELFRQLPNPTPTQRVNHDRLNGLWDDLWDLSRM
YVERIKVLESVLNGMVEVADIVRQHEITLNSFDDLPAALDKLRGHHSQLLEINMVLKVSK
LGAQNEHFSQQQTVIDQLNRNVALLRQHVSRTRINEGHHPDVDAIEDEVQKLNVRWENVN
SQIASRLLAVESALQIQMVYRSEYETEMSWLDTVEETINRLRKPEELRPEQYQQQLDMLI
AEYTNLQEHTQAIEHVNKEGGRFIHEAKIFDAKLGQYSDGIVGIHGPGIKSEFRRTKPQP
KNGSQIVTEELELLNRRFAQLSSLILERRNTMQVLIQNWKRQKQENVTQVVSFREAEVSG
MMTDLTRFRQEIFTTHLTFNSNPESIDAATKNVQNVKQSLDSWRDRIKERLDEIDRLCTE
EGDSLTPEQYSALREMRRQLADEYDTVLRTVEGIHTRLNILSALLIEFSSVTSSMQSWMT
DRTRLAGDIRHKSGDPMRIDEARFEAKSLMDEVIREESRLKTIGASVLKIEQEISAMRDD
VRASGSTDDVGISVDEVYETRRRVEDDYMQLLRQCQDLISFQNRLHAMNDEHSEQARRAD
EWLQMLQNDVEDVDQDPRFQRDEDRIQRIEELNRMAAGGSSQLDDAEQASRRLLTALEGT
NVANDVRARHEELANLRRGKHQKVIDRLSQNMMEAASRKAEAEGVKQAVENLRQWSEQTA
QRTRQPVQLPLTELDLHEARKDEQVLHGEIENRLALIEELEKKAADVGDHASLAELQECK
MKLKRSNSDLKGLRDNIFDAINGLQTVNSEGETLSRAVDSAGAKIRSARLPEAQSEVEAL
QDQADNLERITNNLCNIPNVTRTEPVIQKSKDLRKRVDSCAQELDARMGKLAELESLDAE
FDGAKNKLSSFIGAFDDELKGLEKVSIDKEKLAEQRRQTQDLVDKHSEGNAILDDVEAIA
QKVTAEDPSKTGSAQKSVGELGARLQRQASELKARGDKINKLDSKATSFAESEAAVLGYI
EKQKDQLSTGFPVPATKEGVKSQLLDLERMNKTGKEEQRRVDDARHSARELAREASVEKE
VQDMNQREKKLLDEWEDLADQFDASESQKAAGKINSLVAEIADLDPIGRSRDELQKQKKE
VVELAGDLGSAQTKMLELGAEWEAALGAGIVAQPVFEMNRAATDELNKLAARAGKRLAQR
EKKITETEDEIDKLHADADQIVGALEAIAKDEALQGAPSQLLDPKQVSEKVRQLKESLKP
VGEKMDAFNTDCKLLIKTAGPESDTKELDSLLKKVGDAYSDVVGKVSDKEMSVDAAVQQQ
GKVEDAYRALLNWLEETEEMMENRKKPSADAKVAKAQLHDYEVLMKHVEDKKPSVDGFKA
MIEKIVAEASSDEEKKALGNKNAQIEDRYKDLLNSAVDRQRKLLDAVDLAERLQEVTIPL
DSWLQSADKRLQALAKVPITVEKAEEMIGEQEALQDELEHKSDDLKDVLEIAPMLASLVS
VEDANSISGQVNQLEARARALDAGITNMRPLLESFLQQIQDFTLDAEDMTQFVGETEVKL
GELDELPIEPDDLVEQTNILAEIAVSIADRDEMMANIFEVGKQLAIQGEPEEALIAQKKL
DDLKFRYADLMTSADEKIALLAKAIPLSEGFHEGFDTVMQVLEDMDRDLQTIDEEDPETQ
AELIFLLEEDISQKMRPSVDELTALSNQLQVLCSADKADELQTNTIAMNKLVNSVADRVA
RRAERIEMASKQSRAVLDDLQYLIEWFSAARERILEGAPPSLDLEVLKSQLKHQRITNEE
ASANKVQFRNVAGEAKKVARQLGMEGNEANEKISDTVDEGKELVEEVMALCADRTETLER
ALALMEQLTSQFDELNKWLDQMDAELQASPSVTTATPAAELREMHDHNEELARMVAAYRP
IIEGFKSDVGSLHEVLAEDQAPLLESVAGELVQGYEEVREAVRARGHAIDNMMGATIGFG
ERLETLVANLQGAADRLRENEGISADPSVLESRLAENRSIVESLRDKQNAYDALKQTASE
LLASAPEGDAAAGDVENKLNRLEKLWKEIEREAVDRGVLLEDVLDKAKHFWSELDSCQKA
VDDLRNRLELVEPATGHPEQLADQQEIMAQVASEMERARPRIEALSIAGKQLADYVPDDE
KAVIENQVANVRGGFSTITGLFAEKKRDLIAAMEEAMTFHGDLQELLKWLDMAEQKLLKM
SPVEHAKHMTEIEQLLKELHTFKDEVHERGVAKEQVVATALQLAADAPPHLAATVRQPVA
DLNTRWSRLNAALAEREHKLENLMLQMGKLASTIAQLTAWMDKTRATLKDIAPPKNAVNL
RDIEIAQCKLVVLSNDIHAHQDSVNAVNRAAQKYIQTSGALDAETSDSLKSMNLKWEDIQ
KVLESLAFDMEVAKKEAENVGGEVEKWQRWLEETESALLSTKPTGGLPETAEFQLDEFKA
LKLDVEHNASPLEAHLHATEQHLKEEPQDADTWLSKTHGAMKTKWNKVKELLVDREKKLQ
VAYEQAVALESALNDMEDWIIAAERKLTDQPSISRLPDVIEKQLAEHESWMEEVAGRKMA
MTKHQASGVHMQYYCEKKDAIPIKNRLVSLKHRVEKISGRTAERAKQLAVTRDEVATWQD
GLHDLEHFISDVLVKIAPEPNTTSSLEKLKAKLEEVKEAQRDVTAKQTLFDVTRKRGIGL
AERATRSEYKQISMTNEKMSKKWAEMLKKLRDRLREAEQAVLEGGAFEESMNDLESWVDD
ELERYQKAEHEPVFADIDGVRALVDEESRRSAERKTKENGVKTVVKKADALMASGVDEKD
SIAQAKERLVEKWNQVEEAARHRGNSIKEAEQAAEEFDAKTHALLDWLAVEEQKLKASGL
DEVEGVKQEMDEAKGRYQECLKKGEEILSKCQPAAEPILRNWMRVVEARWKEVSEKVDER
EFTLLEQEQKAKEQNEQIEKLAKFAAQKREELNRMIEQPPAQDLDTMEQNICDFANLDSE
LREQQPEVDAACKSAKKGARNPAAEMLSTEWKKLWLDAMGLQSSLDNQKALLEEMKRLEG
WKWEDWKERYVEWNDHAKARVNDLFRRIDRLHTGNVPRQVFIDGIIGSNYVPNSTIVYSK
FPTSRLEMAKVADRFDKGDGMINAKEFINALRFDASNRNAKPQTDTEKITHEIELQKKTC
SCCTPYQIEKISENHYRFGDTHIKRMVRILRSTVMVRVGGGWESLDEFLHKHDPCRAKGR
LNINMFPEARPIHALDSMRSFTKNRHGKQLPTTGTPGPIMKIREKTDRSVPMSGGLGGTA
GYTVTTDSHRHTDARPSRIPRAPSDMSAGRLSRVGSVSNSKNSIVDSSTPSRPESRASSD
AGDRQTRIPSLRARKGQRYIPQGPSSSSSK
Download sequence
Identical sequences G5ECG5
ZK1151.1g NP_001021859.1.50509 ZK1151.1g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]