SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C01H6.5d from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C01H6.5d
Domain Number 1 Region: 189-437
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.24e-33
Family Nuclear receptor ligand-binding domain 0.00051
Further Details:      
 
Domain Number 2 Region: 9-94
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.55e-30
Family Nuclear receptor 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C01H6.5d   Gene: WBGene00003622   Transcript: C01H6.5d
Sequence length 439
Comment pep:known chromosome:WBcel235:I:7214967:7221188:1 gene:WBGene00003622 transcript:C01H6.5d gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVSAQIEVIPCKVCGDKSSGVHYGVITCEGCKGFFRRSQSSIVNYQCPRQKNCVVDRVN
RNRCQYCRLKKCIELGMSRDAVKFGRMSKKQREKVEDEVQVRMHKELAANGLGYQAIYGD
YSPPPSHPSYCFDQSMYGHYPSGTSTPVNGYSIAVAATPTTPMPQNMYGATPSSTNGTQY
VAHQATGGSFPSPQVPEEDVATRVIRAFNQQHSSYTTQHGVCNVDPDCIPHLSRAGGWEL
FARELNPLIQAIIEFAKSIDGFMNLPQETQIQLLKGSVFELSLVFAAMYYNVDAQAVCGE
RYSVPFACLIAEDDAEMQLIVEVNNTLQEIVHLQPHQSELALLAAGLILEQVSSSHGIGI
LDTATIATAETLKNALYQSVMPRIGCMEDTIHRIQDVETRIRQTARLHQEALQNFRMSDP
TSSEKLPALYKELFTADRP
Download sequence
Identical sequences C01H6.5d NP_001032969.1.50509 C01H6.5d

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]