SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C04F12.3 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C04F12.3
Domain Number 1 Region: 159-384
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.91e-45
Family Ankyrin repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 508-593
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000124
Family DEATH domain, DD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C04F12.3   Gene: WBGene00002069   Transcript: C04F12.3
Sequence length 597
Comment pep:known chromosome:WBcel235:I:9685482:9688648:1 gene:WBGene00002069 transcript:C04F12.3 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKADENDANLTENGVHKSRSDSEINSHTSSIHKSSSQHRRLFIDDISTIEASAGDRVWA
TCSGAGDATELITIHFLGDQFEESAIDVVRKHSLVMFTVPSLKVDSELEVELRFSTSNDN
VTTISFKYLPRKIQRSHTQEISLFDNLLEFATNGDTISLLQPFVAQISKQDIEGNTVFHV
AAKNGQSFSLKLLLSVIPPDIKNEVINVQNTHGLTALHVAIRTGDPDAVHYLMNHGAKID
ISDNHGSTALHYLGDAYNESIFKEILEPSRGQRFDVNQLNSEGFAPIHVAVRRLKLSLIE
MLIEAGALIDFLDTEKKRNALMHAIEMNDFETIQLLVERGSGTNIEDESGETALSLAVKN
VNYPVIGLLLDNGADPNRQNSKGICLADSEDSVIQNIINGDRPELPKKEAFGVPNDLAIS
RSPLFGRSHPDQAPGEESGRHRVVKRSREEILNDAQTLLAETDSMAPRVSRISTSESEDE
QQPGPSTSSGTRRRRSEWDRNPKLSDSVCNLDYLTRIRVAKIFDDQCKWQRLAQQLNCDH
MVELISICSSGDDSSPTMILLDQFEQLEDSSISRLRDAMNQMAEDDAVKLIDSRYVY
Download sequence
Identical sequences G5EFS1
C04F12.3 6239.C04F12.3 C04F12.3 C04F12.3 C04F12.3 NP_492575.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]