SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C06B8.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C06B8.1
Domain Number 1 Region: 1-83
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.38e-21
Family Nuclear receptor 0.0038
Further Details:      
 
Domain Number 2 Region: 149-337
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.66e-21
Family Nuclear receptor ligand-binding domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C06B8.1   Gene: WBGene00007367   Transcript: C06B8.1
Sequence length 342
Comment pep:known chromosome:WBcel235:V:15479544:15481677:-1 gene:WBGene00007367 transcript:C06B8.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCQVCGAAEADLHFGGISCRACAAFFRRFFLSKKQSKKCTCKTRILDSHPCRSCRILKCF
EAGMTSKKIQSGRDKTSTKAISCISTESTSNSLSARIIPRSSLNIHGAVHLWQEFENTRA
CKKGTKRNALIVSTSSAGDMDSTWKMVINLFSSLGELEIKDKTALLRNFMPKFIQIDSVP
YFAANIDVFKNIGRDEYESSIIDFYDGVLPETNTISKKDTIRIFEPYWNFYTNKVILPIA
LMKLEGPEFMALVWLLFFDNGYTNLSDKCREACRNIKKVILRELRSYQIDRNFDRNRFFE
ILEALQLVERGEKKFMEEMVICELLNIKIDPGFMEIIRESKL
Download sequence
Identical sequences O17573
6239.C06B8.1 NP_506854.1.50509 C06B8.1 C06B8.1 C06B8.1 C06B8.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]