SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C06C6.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C06C6.4
Domain Number 1 Region: 5-88
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.65e-24
Family Nuclear receptor 0.0039
Further Details:      
 
Domain Number 2 Region: 129-348
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.00000000000000319
Family Nuclear receptor ligand-binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C06C6.4   Gene: WBGene00003653   Transcript: C06C6.4
Sequence length 363
Comment pep:known chromosome:WBcel235:V:16002595:16004728:1 gene:WBGene00003653 transcript:C06C6.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSTSCHVCGAPEVEPHFGGVSCRACAAFFRRYFHSKKSVISCTCQIRYQNSHPCRECRI
QKCFEAGMNPEKVQVKREKHPKKLKMELAHASLSSASSSQSPPSLPISPLPYHIVSRNNS
TISYIVSTWGEVQDKRSVLYKKRFDDLTYYEACVASKIDSEIMWNVCEYIFPQIQSLSNL
DKNAVLRNFSPKWSLLASSIDFERNCHLYEDVVTVDDYLDMIVKFYSGSMYGDNKISPKE
ILRVFEPFLTYYGVVLVLPMNAKMFNSIEYMALAMLLLFDGAHANISADCSKMCHDIKNV
ILRELRDYYIDNGVDEMRFFETIDTVNHVEKGESKFIEELLACELHNVHIHEDYRLILHE
QKF
Download sequence
Identical sequences O62034
C06C6.4 C06C6.4 C06C6.4 6239.C06C6.4 C06C6.4 NP_741645.3.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]