SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C06C6.5a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C06C6.5a
Domain Number 1 Region: 2-82
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.85e-23
Family Nuclear receptor 0.0022
Further Details:      
 
Domain Number 2 Region: 172-344
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000322
Family Nuclear receptor ligand-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C06C6.5a   Gene: WBGene00003640   Transcript: C06C6.5a
Sequence length 359
Comment pep:known chromosome:WBcel235:V:15997779:16000653:-1 gene:WBGene00003640 transcript:C06C6.5a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACQVCGCSDVEPHFGALSCRACAAFFRRYFHSKKVVGQCNCAVRFRNSHPCRECRIKKC
LSIGMNPEKVQEKRERHPPKKNKPPSISEALTSSSSTPPSLPISQLPSRIIPRDCSSITL
TAFNWQKCQPKRNYMTRTLDETNYYQLSCFKIEDCMMIWRIVEDLFPSLTWNLRKLDKEA
LLRNFLPKWSVLTAAIDMEVKVQRYSKVNNTEEFKRMIVDFFTYSMPEKFKMPPEDILKV
FGPMIVYYVTKIILPIHEKGLDQPEFMALALIILFDGAYSNISVECSEMCRTIRNLIFRE
LKNYQTDKNFDEIQFADTVDTLNIVEKGEKKFYEELLICDMHNVHLHEDYRLLLNELNG
Download sequence
Identical sequences O62031
C06C6.5a C06C6.5a 6239.C06C6.5a NP_507015.3.50509 C06C6.5A C06C6.5a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]