SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C06G3.1b.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C06G3.1b.2
Domain Number 1 Region: 131-406
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.83e-33
Family Nuclear receptor ligand-binding domain 0.0057
Further Details:      
 
Domain Number 2 Region: 37-122
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-22
Family Nuclear receptor 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C06G3.1b.2   Gene: WBGene00003695   Transcript: C06G3.1b.2
Sequence length 413
Comment pep:known chromosome:WBcel235:IV:7050102:7053435:1 gene:WBGene00003695 transcript:C06G3.1b.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTFSDPMDPSIPIFQHHEEEEAGPSTTIKAEEEDGPCCLVCGRVANTGHHYGVTACLGCK
TFFRRVVLQKNSPKCKYKNHCRLEKSVNAKRLCRSCRYQKCLEVGMTEDALHPCRDVIGR
RVRNNSSDSSPISSPPSIPTPLSTITDMDTDIRTRTAHILGEPANGNEQIHFYSPTPDYT
NVIVNHGIGPSLKVDILLLREWVDRIPGFRELSERFQQHLMHRFCLRYTVIEHGLFTAQM
PYHKNVWFLSDRTCLVSEFENLPQEIKKHLTPKVINEQQLLASFTEMLIHEVADPLRRLK
PDSVEVATVKTLMLLKPTCLREIDGDYLSTETDIKSVNDVRNRVINGLYSHYIKNGMDPE
QLPIRVSEILNLTGGVEQCAARALEEMHPTRVFNLSSFDPYSSNVIFGYYRDV
Download sequence
Identical sequences Q3LQX0
NP_001021304.1.50509 C06G3.1b C06G3.1b.1 C06G3.1b.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]