SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C12D5.8b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C12D5.8b
Domain Number 1 Region: 11-118
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.01e-18
Family Nuclear receptor ligand-binding domain 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C12D5.8b   Gene: WBGene00003684   Transcript: C12D5.8b
Sequence length 133
Comment pep:known chromosome:WBcel235:V:7684340:7685332:-1 gene:WBGene00003684 transcript:C12D5.8b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIGKSMKDIDVYRIFEPYWKSYYVHVAYPLFELKFDQMELMALLALMLLDPGYTNISEKC
SEMCHRMRKVIQRELRGYYLENNKPTDRMLKVFEALLLMEKTDRWLQEEVQMCEMYNVQA
DEEFRRMVLVRKI
Download sequence
Identical sequences Q8I7M3
C12D5.8b C12D5.8b NP_872122.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]