SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C17E7.5 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C17E7.5
Domain Number 1 Region: 130-366
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 5.11e-44
Family Nuclear receptor ligand-binding domain 0.0037
Further Details:      
 
Domain Number 2 Region: 37-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.75e-22
Family Nuclear receptor 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C17E7.5   Gene: WBGene00015900   Transcript: C17E7.5
Sequence length 366
Comment pep:known chromosome:WBcel235:V:3866556:3869005:-1 gene:WBGene00015900 transcript:C17E7.5 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCISPTHFFHNMSVFDTPSPSNSSLESSPFSQDLQQKKCAICFRPAFSNNYGVLTCDACK
MFYRRIVILNREYKCKYGGGCAHVAKSTVVKCKGCRYQQCLEAGMTFQPSFAELTNEKDF
DAATTVATLRFLDSRRSNAMKTQFTDEDFSLLEVLEKRRMKMKARRSEITNHEWSFFGIY
TSIEFLMSLDFMSSLNLNIQDKKILLKHYCVKASLFASAMRAMKEQRNTLMTVDGKEIYP
DAILRLKQISPQFLQRIRSLLVMKLIELKITDEEFALVNAIFFCNAALPLSEDGQKTVVT
QQKAYSSALLQFCNVESSRNGPTRFTNLLSLLHVINKNFEDVKAMTMLFRIFVKDVSYRK
IVTDVI
Download sequence
Identical sequences O16388
C17E7.5 C17E7.5 C17E7.5 6239.C17E7.5 NP_504067.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]