SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C24G6.4 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C24G6.4
Domain Number 1 Region: 176-265,420-549
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.1e-32
Family Nuclear receptor ligand-binding domain 0.0014
Further Details:      
 
Domain Number 2 Region: 9-93
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.12e-28
Family Nuclear receptor 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C24G6.4   Gene: WBGene00003637   Transcript: C24G6.4
Sequence length 579
Comment pep:known chromosome:WBcel235:V:5505296:5509956:1 gene:WBGene00003637 transcript:C24G6.4 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEKLPPGTLCAVCDDIATGKHYSVASCNGCKTFFRRALVNNREFVCQGNKDCPVNKGVR
CACRYCRLQKCLAVGMDKNSIQNDRDRIGYTKRKRRHDDNDMEGGVHHSEHIRDGSSGSP
QMNDESPESMDMKDIKIDLNCLDPIADRLTTLENNFTLLLSRCADLHSYATLEDALNAPS
RFMQPISCEWSDNVVLTNRDDKLPFWRQRLIALYIDWAKTFSTFRSLPYADKVAMVTNHA
SSFMIMCEAFRTPEHMKSDVVRKRPDLPNIVTSNSGSGCSRVSSVAGSLVSNGEDVHDDL
TNLLHAACIQQSINKGIMFGENSSDDKILLNLPIREIKKEPLEVPSTEGMIQLPTEYGNL
PADYASWIPQDYGHPTAGHEGKSDMHNFFEARDFCVGRPSSCNLNERSMKTVSMLESRNF
QSPSANNSSLSGITPVLTMMIDLVMKPFRQLNFSTTEFALLQAIMFFDPDTEGLDSASQR
NVVAEQKKLLAVLFRHLQKAYNPQAASERYASIILRMPSIRRAAAKKNESLQVLDMLQMH
EINSLVKETSLGPRPSNVQQRMGIGGGAGGCLTFPSQED
Download sequence
Identical sequences Q17370
AAA93297 NP_504455.1.50509 C24G6.4 C24G6.4 C24G6.4 6239.C24G6.4.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]