SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C25E10.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C25E10.1
Domain Number 1 Region: 5-95
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.91e-28
Family Nuclear receptor 0.00046
Further Details:      
 
Domain Number 2 Region: 168-385
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000139
Family Nuclear receptor ligand-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C25E10.1   Gene: WBGene00016091   Transcript: C25E10.1
Sequence length 401
Comment pep:known chromosome:WBcel235:V:9045171:9046967:1 gene:WBGene00016091 transcript:C25E10.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRSTCKICGLAAHGVHFGVTACRACAAFFRRFVVLNLEYECLKDEIKCNLNKIRRSSCR
HCRFQKCLRMGMTADNVQWNRDVYSNEMRYRKLKIQEIRNDENDASIAYPCNSLPSTSLY
PVIKTEDQLYTKSVLSEINYENLERDMHKMFMSDIPSTDHGYFASLSPIYQVVEGLRLIR
KSQQTFDIQFENRLSLETLVPHWREQAKNTAIMSMHSMAFRNIPLTEKSRIFKSLWQNIY
RFERIQMSTEVFGKDCVNEKKLAISCEKAIQLDALFFDIEGVAQNKLTVTLQDYKIFAER
CVREVAQPLSQLKLSIEEVAFLIINFVLHNEEKIIGESLTVCDKFRDQIADGLHEYYKKN
DIINYAPRIKKMMSTIDAMKRIHYDDLAGEFTTNAKNSKDC
Download sequence
Identical sequences Q18155
NP_505343.1.50509 C25E10.1 C25E10.1 C25E10.1 6239.C25E10.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]