SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C29F9.13 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C29F9.13
Domain Number 1 Region: 43-140
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.87e-21
Family Nuclear receptor ligand-binding domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C29F9.13   Gene: WBGene00016227   Transcript: C29F9.13
Sequence length 143
Comment pep:known chromosome:WBcel235:III:130105:130750:-1 gene:WBGene00016227 transcript:C29F9.13 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSGTRSRSSTKARKGTPRPPALSQSVYCGRRYTGPHTTFFFEITNDEYLLLSVLIFCNP
ALLQLSENGKLLLTIYRNLYCSALLQHCLLNNQKSGPARFTELLGVYQAIEVHYSDLANY
IVLFQLNRPKVNQIVKNCFEAVT
Download sequence
Identical sequences Q9TZB4
6239.C29F9.13 C29F9.13 NP_497150.1.50509 C29F9.13 C29F9.13 C29F9.13

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]