SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C41G6.5 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C41G6.5
Domain Number 1 Region: 41-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.53e-18
Family Nuclear receptor 0.0013
Further Details:      
 
Domain Number 2 Region: 194-364
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 0.0000000000000219
Family Nuclear receptor ligand-binding domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C41G6.5   Gene: WBGene00008056   Transcript: C41G6.5
Sequence length 389
Comment pep:known chromosome:WBcel235:V:15233894:15235761:-1 gene:WBGene00008056 transcript:C41G6.5 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDYGRTRRKRLLMNGSDESENQYAQHYVEFLETMSYTKFGVCAVCGFSCQVQYHFGGVVC
GACSAFFRRTVSLNIRYLCDGDNQCKSMLKKCRACRFESCVKTAGMKRSLVRRKKPTIKT
TPLYIKNRETHVRNEDVLRAFIPSYTHPSPANETVEDKGKFSEKLKLSHGNILKFYINQV
RYAKRKNTNIFTIKTTEDFMRLVNFQRKIADETCSSFPGVELIDENNILILRKYLQFSSV
WIESTWTYWITNSSVSVDNMEMDKRLKELIEHVKSTLLISLSQLKLNIFEFAAFKSFFVW
KLVFHKTSVAMKTIGQEHYECVSSALKSYYQTYTSMDSTEIAVRIGEITLLLSLVFVSKI
DLKSKSSELNFQQIYHDMAKLYVHLGLPF
Download sequence
Identical sequences O17657
6239.C41G6.5 C41G6.5 C41G6.5 C41G6.5 C41G6.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]