SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C45E1.1a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C45E1.1a
Domain Number 1 Region: 120-363
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.97e-49
Family Nuclear receptor ligand-binding domain 0.00000893
Further Details:      
 
Domain Number 2 Region: 24-105
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.93e-28
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C45E1.1a   Gene: WBGene00003654   Transcript: C45E1.1a
Sequence length 369
Comment pep:known chromosome:WBcel235:I:3104363:3109542:1 gene:WBGene00003654 transcript:C45E1.1a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEEKEEVSTSTSQSPQSSSFENVFCAICGDRATGKHYGAMSCDGCKGFFRRTIRKRHS
YVCRFGEKCQVDKAKRNSCRKCRFDVCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVP
DDPLLDTLIRAEASTRGLRTTVITKTAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQ
RVDNITQVALLRHFSAQHLVMCAAFRSIHLSDAVWLTNETCLHKDSPKIPDMNRVAERII
DQVTNPMRSLHMNEIEYIALKAIAFFDPLAKGITSESYSDVEEMRQRILESFERHVRYVS
PYKDMPLRFANLLLLLPPMLAISRDLVEDVQLAKLFGLASIDNLMLELMLPNEGKNTTDK
TSPPIMCHQ
Download sequence
Identical sequences O44960
C45E1.1a C45E1.1a C45E1.1a NP_001021042.2.50509 6239.C45E1.1a

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]