SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C45E1.1b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C45E1.1b
Domain Number 1 Region: 95-338
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.57e-49
Family Nuclear receptor ligand-binding domain 0.00000893
Further Details:      
 
Domain Number 2 Region: 24-80
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.4e-16
Family Nuclear receptor 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C45E1.1b   Gene: WBGene00003654   Transcript: C45E1.1b
Sequence length 344
Comment pep:known chromosome:WBcel235:I:3104363:3109542:1 gene:WBGene00003654 transcript:C45E1.1b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLEEKEEVSTSTSQSPQSSSFENVFCAICGDRATGKHYGAMSCDGCKAKRNSCRKCRFD
VCLRKGMRRDAVQTERDRIRPANPLSNGSNGGIVPDDPLLDTLIRAEASTRGLRTTVITK
TAEARKQATTNDVTDSMNQQLTLMVEWAKVLEGFQRVDNITQVALLRHFSAQHLVMCAAF
RSIHLSDAVWLTNETCLHKDSPKIPDMNRVAERIIDQVTNPMRSLHMNEIEYIALKAIAF
FDPLAKGITSESYSDVEEMRQRILESFERHVRYVSPYKDMPLRFANLLLLLPPMLAISRD
LVEDVQLAKLFGLASIDNLMLELMLPNEGKNTTDKTSPPIMCHQ
Download sequence
Identical sequences C45E1.1b NP_001021043.2.50509 C45E1.1b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]