SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C45E5.6a.1 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C45E5.6a.1
Domain Number 1 Region: 278-524
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 8.91e-38
Family Nuclear receptor ligand-binding domain 0.0028
Further Details:      
 
Domain Number 2 Region: 97-179
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.99e-22
Family Nuclear receptor 0.00091
Further Details:      
 
Weak hits

Sequence:  C45E5.6a.1
Domain Number - Region: 15-75
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0128
Family beta-sandwich domain of Sec23/24 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C45E5.6a.1   Gene: WBGene00003636   Transcript: C45E5.6a.1
Sequence length 528
Comment pep:known chromosome:WBcel235:IV:5747382:5749890:-1 gene:WBGene00003636 transcript:C45E5.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSDWSTDFFHQSQTPNPYPPIVQQQQQPPHTSSSFFNTNHQLNSHYSSPIHQPPTSLHQ
PIPMMQNQFKASPPQSDQETAPTTPGSGSGGQMKGERCVGCGSESAIRVHYGASSCHGCK
AFFRRSVFEGRVYMCSADNHCDITNESRNRCRACRLRNCLEGGMNPKHVREERSKIERMP
GNTCTVSAANGVSHSSSAASASPEHKFSFSLSTIAPSTSTGSFSSGSQPAPIESTNSSGS
EAEVLDRKLIQENQLTLFMVALEKQTEQLTDDDVKDNDVMGAWSRDITLTFGLQHPQMVI
KRLPLKYSCDRIMEAADLYLSWYRSFVFAADWAMGIPEFRVLPLADQTTLFKQNFMAFGW
ITFAYKCFELKQHLTGMPLGNGAYIPYNDEDQKKLPERWAQTYGVVCRKLIDLIVKAMIE
LQITEEEYCLIKTISLFQQDCILSEAGQGICSRMRDRLLDALSAHIEKRYPYHTTSQRMT
RALKISLMLPSFSHIGQVESTLITQLTAADLHQLSGVPMEICTAQTTL
Download sequence
Identical sequences H2KZB8
C45E5.6a.1 C45E5.6a.2 NP_500858.2.50509 C45E5.6a C45E5.6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]