SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C47F8.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C47F8.2
Domain Number 1 Region: 10-98
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 6.73e-23
Family Nuclear receptor 0.001
Further Details:      
 
Domain Number 2 Region: 170-315
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.42e-16
Family Nuclear receptor ligand-binding domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C47F8.2   Gene: WBGene00008158   Transcript: C47F8.2
Sequence length 362
Comment pep:known chromosome:WBcel235:I:12331085:12333413:1 gene:WBGene00008158 transcript:C47F8.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRSEFPNSKCLICGSICTAKFHFGGLSCNACASFFRRTVSLNIRYLCKNSNNCITSPGQ
RTFCKACRYESCVDKAGMKRDFVQQRRSTNATPKYILNSTSGSSNREVVRGFITDSNSHL
VTQTDHLRNIDNNEHCKDMKKYSDLLEISHMNLLRFYVKQVEPEKKELKNILQIKSINDL
MITCAYDNGSAMESCVHCPGTGKLSQEDVRLLQKSFQFAHTWLDSTWQYSIATDIDESEV
SGESENLSQFISHIKSTLGACLANLKLDVYEFAAFKSFCVWSIGAQGATESMKVVAQEHY
EAVASALKMYYKTFTSMSDSEIATRIEEISFGRSSDVQMIYDETIKLYNKIGIPKSLFFE
GN
Download sequence
Identical sequences O62112
C47F8.2 NP_493119.2.50509 C47F8.2 C47F8.2 C47F8.2 6239.C47F8.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]