SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C50B6.14a from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C50B6.14a
Domain Number 1 Region: 173-375
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.98e-45
Family Nuclear receptor ligand-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 29-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.26e-24
Family Nuclear receptor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: C50B6.14a   Gene: WBGene00003719   Transcript: C50B6.14a
Sequence length 399
Comment pep:known chromosome:WBcel235:V:13329193:13331011:-1 gene:WBGene00003719 transcript:C50B6.14a gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPSCSNSPVDLPEIIPQLKVYAERPKDCFVCGGSASGYHYDVPACNGCKTFFRRYVIS
KRLFTCKLNDDCFDLSTRDVPVKCRACRINKCFAVGMNPHALEVDKTNTDCLKEVTKRKN
MIGNDAVNEKQLVLNSLESMENKIQKIADMLTYLELKLDQFRASSYNPHWAEPMPGWPLL
DNNLSPSRPPPLSHEKLVIGGPPPYSPKKKHWLYFNMLATIEYAKTFMFFHELLPRDQLI
LIRYTTLACVNLLVSFSSVSKKYDTAVHPDGTLQMHRNQEYYSSNVMSIIPLIRYQVQQI
EYVLLKAICLCNPAVPDLSKHAQLLLAEERQKYSEALLDHCIRNIGNGPSRFTDLIGIID
VLERQQRMQKDLHLLYIAPLVAKTPKDNIVQIIEDVMDS
Download sequence
Identical sequences C50B6.14a C50B6.14a NP_001122886.1.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]