SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C50B6.14b from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C50B6.14b
Domain Number 1 Region: 193-396
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 4.06e-45
Family Nuclear receptor ligand-binding domain 0.0038
Further Details:      
 
Domain Number 2 Region: 29-111
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.57e-24
Family Nuclear receptor 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: C50B6.14b   Gene: WBGene00003719   Transcript: C50B6.14b
Sequence length 420
Comment pep:known chromosome:WBcel235:V:13329193:13331019:-1 gene:WBGene00003719 transcript:C50B6.14b gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDEPSCSNSPVDLPEIIPQLKVYAERPKDCFVCGGSASGYHYDVPACNGCKTFFRRYVIS
KRLFTCKLNDDCFDLSTRDVPVKCRACRINKCFAVGMNPHALEVDKTNTDCLKEVTKRKN
MIGNDAVNEKQLVLNSLESMENKIQKIADMLTYLELKLDQFRASSYNPHWAEVRGLEFVL
NSTNRISLADKFGPMPGWPLLDNNLSPSRPPPLSHEKLVIGGPPPYSPKKKHWLYFNMLA
TIEYAKTFMFFHELLPRDQLILIRYTTLACVNLLVSFSSVSKKYDTAVHPDGTLQMHRNQ
EYYSSNVMSIIPLIRYQVQQIEYVLLKAICLCNPAVPDLSKHAQLLLAEERQKYSEALLD
HCIRNIGNGPSRFTDLIGIIDVLERQQRMQKDLHLLYIAPLVAKTPKDNIVQIIEDVMDS
Download sequence
Identical sequences A5JYV4
NP_001122887.1.50509 C50B6.14b C50B6.14b 6239.C50B6.14b C50B6.14b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]