SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for C54D1.5.2 from Caenorhabditis elegans 76_235

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  C54D1.5.2
Domain Number 1 Region: 946-996
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 2 Region: 287-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000781
Family EGF-type module 0.044
Further Details:      
 
Domain Number 3 Region: 736-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000963
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 4 Region: 450-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000204
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 5 Region: 994-1042
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000226
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 6 Region: 835-882
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family Laminin-type module 0.00098
Further Details:      
 
Domain Number 7 Region: 403-452
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000209
Family Laminin-type module 0.0081
Further Details:      
 
Domain Number 8 Region: 792-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000725
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 9 Region: 890-943
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000106
Family Laminin-type module 0.0059
Further Details:      
 
Domain Number 10 Region: 347-397
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000053
Family Laminin-type module 0.037
Further Details:      
 
Weak hits

Sequence:  C54D1.5.2
Domain Number - Region: 102-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00112
Family APC10-like 0.04
Further Details:      
 
Domain Number - Region: 697-738
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00921
Family Laminin-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: C54D1.5.2   Gene: WBGene00016913   Transcript: C54D1.5.2
Sequence length 1633
Comment pep:known chromosome:WBcel235:X:7143918:7151235:-1 gene:WBGene00016913 transcript:C54D1.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSILWLFSLAVLWHMGQPQPAELYPSVDPNHFGADGNPCYDRATRQPQRCVPDFVNAAF
NLEVQVTNTCGTKRPTKFCVQSGHTGQRSVCETCDDRHEGFSHPAKYLTDFNVGNNETWW
QSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFY
SGSCRATYGLSDRAPILPGNEATAQCTKEFSDISPITGGNIAFSTLEGRPSAHAFEESEV
LQKWVTASAIRISLNRMNTFGDEVFKDPQVLRSYYYAISDFAVGGRCKCNGHASECVGSS
SVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQ
QLFEETGHGGHCIDCQGNTQGVHCEQCIANHWRRPGENYCVACGCNEIGSLSTQCDNEGK
CQCKPGVTGRFCDQCLDGFYDFSTNGCKNCGCETSGSLNNQPRCDSSSGSCSCKLNVEGR
QCDKCKPGYFDLSTENQFGCTPCFCFGHSSICNTADGYFAMNVSSVFDQDKQKWAGQNRI
GLQDTQWAELDKAVAVSDTDNSPVYFVAPEQFLGDQRSSYNQDLVFTLKVAKHVTNQDVK
DIIIVGADRQELSTSITAQGNPFPTTEAQTYRFRVHADPYFGWYPRINELDFIGILSNIT
AIKIRGTYSYKDIGYLSNVNLGTAGVAPSAANPKQATWIEHCECLPGFVGQFCESCESGF
RRETKFGGPFNHCIKCDCHNHSNSCEAESGSCICEHNTAGDTCERCARGYYGDALQGTEE
DCQKCPCPNDGPCILHADGDVICTECPNGYTGRRCDECSDGYFGNPKDGTECVECACSGN
TDPNSIGNCDKITGECKKCIFNTHGFNCENCKPGYWGDALIEPKGNCQSCGCFAAGTRRP
NNDYTLLECNQQDGQCDCLPNVIGIQCDQCAHGFYNITSGLGCQECNCDPLGSEGNTCDV
NTGQCQCKPGVTGQRCDRCADYHFGFSANGCQPCDCEYIGSENQQCDVNSGQCLCKENVE
GRRCDQCAENRYGITQGCLPCDDCYTLIQSRVNVFREKVKSLDNTLQEIIENPAPVNDTK
FDEKVKETSRAASEVWEAVKQKTKEGGGTIKTKSKAIKDEIVAALEKLTSIDESVAQAKV
GADAAENDMKRWEIIIENARREIENVLHYLETEGEERAQIAYNASQKYGEQSKRMSELAS
GTREEAEKHLKQASEIEQLSEQAIANATQANKEASDAIYGGEQISKQIAELKEKQNQLNE
SIHRTLDLAEEQKKSADEANNLAAVSLTNVEAVKIPSVDPKELRNDVAGVLEESENLVDS
SVKENSANDELFDEVNRSVADARNELQSSQDQQRVSDQLMLELEKSRERIVDSVSTADKT
LKDAEAALQVLEEFGAKIEKSRNDAVAEFAGVEGINQRLDDIIDAQDKRRNSLPIDKQFV
IDYRKSADVLLNETHALADRYKDIIHSDVDTRDSTEAVQYDIEQLMEELTDSNENLQYYK
KQAEDDKQMATEAVRKATLAKNSAIEANATILAEEDEIKKIINSLDTMEEVNNAELDELE
EEIDRLDQLLAQAQLAKEVPTYQQYRADEDVKVAQLKNDISELQKEVLNLEEIRDNLPTK
CFNVINLEQEGQK
Download sequence
Identical sequences Q18823
C54D1.5.1 C54D1.5.2 C54D1.5 C54D1.5.1 NP_509204.3.50509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]